Identifiers and Description

Gene Model Identifier

Contig17848.0.g2

Standard Name

RTT103b

Aliases

Contig17848_0_g2

Description

RNA polymerase II-binding domain.

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam04818 ) RNA polymerase II-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17848.0.g2(coding)
ATGAAATCTTAAGATTTAAGATCAAGTCTTCAAAACCAACTAAAGATCACTACAGATGGA
ACTACCTCTTTCATGATGGGGGATCAGCTGATGACAGAGTGTGAAGAATCAAACCCTTCA
ATCGTTCAGTTTGTTACAACTTCAACTATTGAACTCTCACTAGAGTAAGAAGAAGAGCTG
AAGAAACTGTCTTTGAAACTTGATCAAGTTACGGGAAGCAAAGATTCAATCATTCAAACA
GGTTAGGACATTATCAGACTCACTTAGACTTACCCTTAACTCGCCTCAGCAGTCGTAAGC
ATTTGGTGCAATAAAGCTTGTGGAACTAATCAAAATCAAGAAATGGATGCAGTCAAGGAG
CTCACTAAAAATTCAGTGGTTAACAACAAGAGAAAGACTGTGACTATGATTTTTTTGGCT
AATGAGGTTATCAACAAGAGCAAAGCTATTGAAGCTAAAAAGCAGTAGTAGCATCTTGCC
TAGAAGAAGTAAATACTAGGTGACTCTTTAGATGAAACTAGAAAGAACGAAGAGTCTGCC
ATGAAAGATTTTACTGCAGACAGTGAAATTCTTTCACCTCAAGTCAAGCAATTAGAACAA
CAAGATGTGTCATTGTGGAGAGAGTTTGAGAAAGTGATCTCTGACACAATTCCAAATTGT
TTCTAAAATGTGATCAAAGTGAAGAAAGATCGTGATGATATTCTGAGAGTTGTGAATATT
TGGAAGGACAAGCAAATCTTTGATTCTGGAATCCTTGAGAGCTTGTATGAAACTCTAAAA
GATTTAAACTCAATGGAGGTTAACTCTTAAGGTAAATAAGAGAATTTGCCAGTTGAAAAG
TCAAGAAGATCATCAAACAATAAGCTTGCAACTTAAAGTGGTGATGATGAGTTTGTTCTA
CAACACTTGACTATGAAAGATTTGGAAAAGTTTGGTTTGGAGTTTTAGCTTAGTGAAGCT
TTGGTATCCATAGCAGAGTTAAAATCTTATCTTGAGGAGAACTGTAAACAACAGGCTAAA
CTCGAAGCTGACCTCGATTTGATGTGTATGAACATAGCCGTAGTAGATGAGATTGATTTC
GAGTGCAAAATAGACTAACATAAGAAGTTAGTTGAGCAAGTCAGTCATCTGAGAAGAGAA
ATGCTTCAATTAGTGAATTAGTAGTTCACTAAGAGTGATAATCAGTAGTTTCAGAGTGTT
CTGATGCTCAAGAAACTTGATGAGTTAGGTTACAAAGTTGATGATTTGAAGAGAAAGAGT
GAGATTGCTAATAGAGTAGCATTATGA


>Contig17848.0.g2(protein)
MKSQDLRSSLQNQLKITTDGTTSFMMGDQLMTECEESNPSIVQFVTTSTIELSLEQEEEL
KKLSLKLDQVTGSKDSIIQTGQDIIRLTQTYPQLASAVVSIWCNKACGTNQNQEMDAVKE
LTKNSVVNNKRKTVTMIFLANEVINKSKAIEAKKQQQHLAQKKQILGDSLDETRKNEESA
MKDFTADSEILSPQVKQLEQQDVSLWREFEKVISDTIPNCFQNVIKVKKDRDDILRVVNI
WKDKQIFDSGILESLYETLKDLNSMEVNSQGKQENLPVEKSRRSSNNKLATQSGDDEFVL
QHLTMKDLEKFGLEFQLSEALVSIAELKSYLEENCKQQAKLEADLDLMCMNIAVVDEIDF
ECKIDQHKKLVEQVSHLRREMLQLVNQQFTKSDNQQFQSVLMLKKLDELGYKVDDLKRKS
EIANRVAL