Identifiers and Description

Gene Model Identifier

Contig20985.0.g55

Standard Name

RTT103a

Aliases

Contig20985_0_g55

Description

RNA polymerase II-binding domain.

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • [acyl-carrier-protein] phosphodiesterase activity (IEA) | GO:0008770

Biological Process

Domains

  • ( pfam04818 ) RNA polymerase II-binding domain
  • ( pfam04336 ) Protein of unknown function, DUF479

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20985.0.g55(coding)
ATGGAAAGCATGATTATTGATTAATCACAAAGCATGAACTAATTTGAAGACTATGACCCC
ATTTCAACCACTCAGTATTAACAACCTGTGCAGCATAGAGTTGAAGTAAATATGTAGCTT
CTCTAGCCATAGCAGTAGAATATAAATGAAAAATTGCTAAACTAGTTTAATCCTTATTCT
GGGTTGAGTGCTGAAGATCTTTAAATCTTGGATGAAATTGAGGATAGAATGCGCAAACTG
GAAGCAACTCAGCACTAAATCTAAGATACTACTACTTACATGCTGGAAATAGCTCGCTAA
ACCCCTCAGTTAGTGCCTTTCATAGTGGGAAAGTGGTGCTCTTTTTTACTGAGAGTAAAC
AGAACCAAGAAAGTTGCTTTTGTATACTTGGCCAATGACTTGATTCAAAAGTCACTTGTT
GAACTTACCTAAGGAAAAATTCCACAAGATTAGCTGACATTTTGCAAGGCTTTTGAAGCA
TAGATTATGGAGAAAGTTTTGCTGAAATTATTTGAGATTTTGTAGAAATCGGAGTTTTTG
AATGTGAAATTGGATGTTCTGAAAGTTGTTAAAGTTTGGACTTAAAGATCAGTTTATGAT
CCTGAATGGCTTAAGGAGTTGAGAACATAATTGATGAAAGTTGGAGGGATTTCTGAGGAA
GATCTCGATAGTAAAACTTAAGCAAGAAATCAATAGAACAAATCAAGTGGTGGAGGAGTG
TTTGGCACAGTAGAAGATCAAGATGATAAAGAATTCGATGAAATCATGAAAATTGAGCCA
ATAAATATTGAGAGTCTCGCTACGATCAACATGACTTCAGGTTTCTAAGGAGGTCCCTAA
ACTTCAAATATTGAAATAAACCCTAATTGGACACAAATCGCTGAAAGTATGAAATTTATC
CAGGATAATAGAGCTAAACTGGCAAAACTTGAGAAGGACCTGGACTATATGGCAGAGAAC
CCATAACACTCAGACGAGATAGACTTAGAATGCAAATTGAACGAATATTAATCTTTGCTC
TCACTGCAAAGAACTTATGAGCGTGACCTTCTTAAATGTCCCCTAAAATTCTTCAATAAA
ATTGAGAATTAGAATTTCCAAGAAGTGCTCACTCTCAATAAAATAGATGAAGCCATCACC
AGAGCAATTAAAATTAGAATCTAAATGAAATAGCTATAACCTCAATAATAAAGAATGTTT
TGA


>Contig20985.0.g55(protein)
MESMIIDQSQSMNQFEDYDPISTTQYQQPVQHRVEVNMQLLQPQQQNINEKLLNQFNPYS
GLSAEDLQILDEIEDRMRKLEATQHQIQDTTTYMLEIARQTPQLVPFIVGKWCSFLLRVN
RTKKVAFVYLANDLIQKSLVELTQGKIPQDQLTFCKAFEAQIMEKVLLKLFEILQKSEFL
NVKLDVLKVVKVWTQRSVYDPEWLKELRTQLMKVGGISEEDLDSKTQARNQQNKSSGGGV
FGTVEDQDDKEFDEIMKIEPINIESLATINMTSGFQGGPQTSNIEINPNWTQIAESMKFI
QDNRAKLAKLEKDLDYMAENPQHSDEIDLECKLNEYQSLLSLQRTYERDLLKCPLKFFNK
IENQNFQEVLTLNKIDEAITRAIKIRIQMKQLQPQQQRMF