Identifiers and Description

Gene Model Identifier

Contig9434.0.1.g20

Standard Name

RTS2

Aliases

Contig9434_0_1_g20

Description

Domain of Kin17 curved DNA-binding protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam10357 ) Domain of Kin17 curved DNA-binding protein
  • ( pfam12874 ) Zinc-finger of C2H2 type
  • ( pfam12171 ) Zinc-finger double-stranded RNA-binding
  • ( pfam01414 ) Delta serrate ligand
  • ( pfam04502 ) Family of unknown function (DUF572)
  • ( pfam09734 ) RNA polymerase III transcription factor (TF)IIIC subunit

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011970602.998577119979921e-31hypothetical protein
SGDYOR077W9.997764199084386e-16RTS2 SGDID:S000005603, Chr XV
from 471899-472597, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9434.0.1.g20(coding)
ATGCAATCCGTAGTGTTAGGGAAGCACAAATACTACTGTGAAATGTGCAAAAAGCAGTGC
AGAGATGAGAATGCATTTCGCCAGCACAAGCACTCATCCTTCCATCAGCAGAGAATGATG
GAGTTTCATACAAATCCTTAATAATTCATAGAACGATACTCAAAGGAATTCTTGGATCAG
TTTAATGAAATATTTCGCATTAAGTTTGGATATAGTGGATTCATCCCTGCAACAAAAGCA
TATAATGAATATATCAAGGACCCACATCATACTCATTTAAACTCTACAAAATGGGCTAAT
CTCAGTGAATTCGCACAGTATCTGTAGGATGAAACTGATTTGTATGAAATATCCAGGGAA
CTAACAGGAGTGAGTGCATCAGGTGAGAAAAATTAAGAGCAGCTCATGATTAAAATGATA
GATAAGAACTAAAATGCAAAGGAGGGTATGAATGAAAGAGATCGCAAGGAGCATATGAGA
GAGCTTGAGAAACGAAGAGAAGAGAAAGACCTAGAGAAAATGATTAAGAAAGCCAATAAA
ATGCAAGCTGAATTAGAAAAGAAAAAGTAGGTTCAATTAGATAATACAAGTCAGAGTTTA
GACTAATGAATGAAAAGATTTAACATGATGAGAGGTAACGATGATGATGCAAAAGATTAA
ATGTTATTGCTCTAAAAATCAGCTCATAAGCCATCAGTTTTAGATAATATCATTAAGCAT
TCAACTTCCTTAATAACTTAAACTAAATAAGAGAAACAGAGCAATTATGAATAATCAATA
TAATCATAAAAACAATAAGAAATTCTTAAACCTTTAGCTGAGAGACCTCAATGGGTTCAG
AGAAATTTGATAGTAAAAATAAAGAATCCTTAATCTGATTATAATAACATGAAAGCGATA
GTTTTGCAAGCATATGACAAAGATAAAATGATTTTGTCTTTACTAAACGAAGATAAAAAT
GAAATTTAAGTCAAAGAGAGTGAAATTACAAAAGTTTTACCAACTGAAGGTGGAAGAGTC
ATGGTTCTAAAAGATAGATTATGTGGGGAAGTGAGAGAAATAGATATGAAATACAAAGAA
ATGGTGATTAGATGTGATGGCAGAGATGGCAAGAAAATTAGAGTTAAGTTTGATGAAGTC
TGTAAAATTAATTCATGA


>Contig9434.0.1.g20(protein)
MQSVVLGKHKYYCEMCKKQCRDENAFRQHKHSSFHQQRMMEFHTNPQQFIERYSKEFLDQ
FNEIFRIKFGYSGFIPATKAYNEYIKDPHHTHLNSTKWANLSEFAQYLQDETDLYEISRE
LTGVSASGEKNQEQLMIKMIDKNQNAKEGMNERDRKEHMRELEKRREEKDLEKMIKKANK
MQAELEKKKQVQLDNTSQSLDQXMKRFNMMRGNDDDAKDQMLLLQKSAHKPSVLDNIIKH
STSLITQTKQEKQSNYEQSIQSQKQQEILKPLAERPQWVQRNLIVKIKNPQSDYNNMKAI
VLQAYDKDKMILSLLNEDKNEIQVKESEITKVLPTEGGRVMVLKDRLCGEVREIDMKYKE
MVIRCDGRDGKKIRVKFDEVCKINS