Identifiers and Description

Gene Model Identifier

Contig15880.0.g54

Standard Name

RTFDC1

Aliases

Contig15880_0_g54

Description

Replication termination factor 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • ryanodine-sensitive calcium-release channel activity (IEA) | GO:0005219

Biological Process

Domains

  • ( pfam04641 ) Replication termination factor 2
  • ( pfam13445 ) RING-type zinc-finger, LisH dimerisation motif
  • ( pfam11789 ) Zinc-finger of the MIZ type in Nse subunit
  • ( pfam06459 ) Ryanodine Receptor TM 4-6
  • ( pfam02724 ) CDC45-like protein
  • ( pfam08690 ) GET complex subunit GET2
  • ( pfam07897 ) Protein of unknown function (DUF1675)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001940403.0006824396935516e-51hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15880.0.g54(coding)
ATGGGAAACGACGGTGGTAGTATACCTCACAGAGCAGAAGTAGTCAAGCAAAAAAAGAAA
GAAGAGCGTAAGGACTAATTTGAGATGGCCCGTGCCAAGTCTAGACTTTGCGCAATATCC
AAGAACCCCTTAAGAGAGCCAATTGCAGTCTGTAAATTAGGACTTTTATATAACAAAGAG
GAGATAATCAAGAGATTAATTGAGAAGGAAGTGCCTAGGGCTTTCAGACACATAAAGAAA
CTTAAAGATGTCAAGGAAGTTAAGTGCTAGACAAGAGTTGACCCCAAAGATGACGATTAT
ATAGTATTGGTGTGCCCAGTCTCTCAAACTGAATTCAATGGATTTAACGCTTTCTCTGTG
TCTTGGCCATGTGGTTGTGCGTTCAGTGACGAGGCCATGCAAGAACTTAAGAGCAACGAG
AAGTGCTTAAACTGTGGAATTGAAATTAAAAAGGAGGACATAATCTCCCTGAATCAGACC
GCAGATTAACAATTAGACTACTTAGTTGCCTTTGACGAGAAGGAACGCATTGAAAAGGAA
GAAAGAGACAAAAAGAAGAAGGCCAAGAAAAACAACAAACGTAGTAACAAAGATCGTGAA
AATGGCTCTGACCAAGAAGAAATCAAGCAGGAGGAGAATTCTGATGGAATTGATGCTAAT
AAGAGATAGAAAGCTGACTAGAATAAGAAACCAGAGGAGAAGAGTGAAGTGTTCAAATCA
CTGTTTCATAAGCAATATGAGGAGAATAAGGATATGGATTTCTTGTGCAGAAATGTAAAA
TATGGACTACATTGA


>Contig15880.0.g54(protein)
MGNDGGSIPHRAEVVKQKKKEERKDQFEMARAKSRLCAISKNPLREPIAVCKLGLLYNKE
EIIKRLIEKEVPRAFRHIKKLKDVKEVKCQTRVDPKDDDYIVLVCPVSQTEFNGFNAFSV
SWPCGCAFSDEAMQELKSNEKCLNCGIEIKKEDIISLNQTADQQLDYLVAFDEKERIEKE
ERDKKKKAKKNNKRSNKDRENGSDQEEIKQEENSDGIDANKRQKADQNKKPEEKSEVFKS
LFHKQYEENKDMDFLCRNVKYGLH