Identifiers and Description

Gene Model Identifier

Contig1153.1.g18

Standard Name

RTF1

Aliases

Contig1153_1_g18

Description

Plus-3 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGL244W0.0002999184360822198RTF1 SGDID:S000003213, Chr VII
from 41498-43174, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1153.1.g18(coding)
ATGTCAGATCTACAAAATAACTAGGGAGGTATAGGCACCGCTCAAACCCTACAGTAAAGA
AAGGCTCAACAGAAAAAATAAGGAAATCAGCCAAATTCACAAACTAGGGCAGGCGGCTCT
CTAGCTTACTACACGACTGCTGATATCCCAAAACTAATCAAAGAAGAACTTGGGTTCAAC
TAGGAATATTTATTCAAGGATTACGAGGAAGAAATGGAATTGAAAGACACTAAGAAAGGT
TTCGAGATTGATGTGCTCCTTGAAGAAAGATTTCAAAAAGTGTAAAAATTGGAGGAGAGA
CTCAAGTTTCAATTGGATGAACAGAAAAACTAGTTTTCTTAGCAGTTTTTGCTAGAAAAT
CAAAGGGTTCCAGGTAAAAGGAGATTTAGAGATGACTCAGAAGGTAGTAGAGAAAGCAAA
GATTCAAATTTTGATTCCTCAAGTGATAGTGATAGAAGTGGTTAAAGTTCCTCTGAGGAC
AATTACGAAAACCCTGAGAGAGGTGCTACCGATAAAAACAGAAGATAAGAAAAGATGGAT
CGTAAAACTGCAGGCTACCAAAAAGACCAATTTTCTTCTGATAGCGATATCGAAGTCACT
CACAAGGGAGCACCCTCCAGATTTAGCAGAGATTAAAAATAAAAAACACAATAAGACCAA
TAAATCTCCATAGTATAAGAAGTATATCAATTAGATTAATTGAAGAAGATCATTTTAAAG
AGAGCTAAGTTGGAGTAGTGGGTTGAATATACCTATTTCAAAGAAATAGTTGTAGGATGC
TTCGTAAGGTTTAGTTTCTCAGGTCGCTACAGACTAGCTGAAATTGTGGAAGTTAAAGAA
AACCCTGGCAATGAATATGAACTAGGGAAGTTTAAAACATCATTGTAACTTGGTCTAAGA
TTCTCAAATACAGTTAGATTCTTCAAGCTAATTCTAGTTTCTAATGCAGATCCAAACGAG
GACGAATTCAGAGAAATGTTAAAAGTCAGATAAGAATGTAAACATAAACCCATAACAATT
GAGCAAGTTCAATTGAAAGCAAAAGAAATCAAGAGGTACGAAGATATGACTAACAAGCCA
GAGGAAGTCGAAAATATGGTTTCTATTAAATTCAAGAAGAGAATGTAAGAAGGTAAACTA
GCAGGGCTCAATCTTTCTTTCGTCAAAGTAGAGCTGGCAAATAACATCGGACTGTTTAAG
AGAAAACTGTAGGATGAGGATGTATAGAAAAATCCTACTCTCTACTTAGATATCTAAAAT
CACATTGCTGTTCTTGAGAGAGACCTTATAAAAGTAGAATAAGCAAATGTAGAAGAAAAT
CTAAAAAGAGGAAATTTCCTTAAAACAGGAGAGCAAGGTCAAGAAAGGTACTAAAATATC
GAAATGCTCGAAAAGATAAAAGAAGCAGAAGATTGGGTTAAATATCAAGATTACATGACT
GAAAATCCAACTTCTAAGAAGCCAACATTTTTCATGAAAATGAACAGACAGGACAGCACA
TAATTAACAGAATCAGAAAAGTAAAAGAGAAAAATATAGAAGGAACTATAAATGATCAGA
TAAAGATCTCAAGCCACTTTTGAAGAAAACAAGAAAGAGACTTACTTTTAATAGATGGAG
AGGATGAAGCGTGAGCAATCAATAATGAACAATAACATAACTTTCGATTTTGAGAAGAAT
TTCACAATTTAAGAGAGCATTGATGGAAAGAAAACTGTCGCTGGGCTTGATTACGAAACT
AAGCCAGCAATTGAAGAAATAAAACCAACTTCCGCTCATCCAAATTGGCTTGAGTACTTT
AACTAGAAATGCTATTAAGAGAGTTAACAAGTTAGTTAACATGCTAAAATCATAAGTTTT
GACGAGTATTTTTAACAGTGA


>Contig1153.1.g18(protein)
MSDLQNNQGGIGTAQTLQQRKAQQKKQGNQPNSQTRAGGSLAYYTTADIPKLIKEELGFN
QEYLFKDYEEEMELKDTKKGFEIDVLLEERFQKVQKLEERLKFQLDEQKNQFSQQFLLEN
QRVPGKRRFRDDSEGSRESKDSNFDSSSDSDRSGQSSSEDNYENPERGATDKNRRQEKMD
RKTAGYQKDQFSSDSDIEVTHKGAPSRFSRDQKQKTQQDQQISIVQEVYQLDQLKKIILK
RAKLEQWVEYTYFKEIVVGCFVRFSFSGRYRLAEIVEVKENPGNEYELGKFKTSLQLGLR
FSNTVRFFKLILVSNADPNEDEFREMLKVRQECKHKPITIEQVQLKAKEIKRYEDMTNKP
EEVENMVSIKFKKRMQEGKLAGLNLSFVKVELANNIGLFKRKLQDEDVQKNPTLYLDIQN
HIAVLERDLIKVEQANVEENLKRGNFLKTGEQGQERYQNIEMLEKIKEAEDWVKYQDYMT
ENPTSKKPTFFMKMNRQDSTQLTESEKQKRKIQKELQMIRQRSQATFEENKKETYFQQME
RMKREQSIMNNNITFDFEKNFTIQESIDGKKTVAGLDYETKPAIEEIKPTSAHPNWLEYF
NQKCYQESQQVSQHAKIISFDEYFQQ