Identifiers and Description

Gene Model Identifier

Contig246.0.g102

Standard Name

RTEL1e

Aliases

Contig246_0_g102

Description

Helicase C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006844901.9995541014149208e-99DNA repair helicase (rad3)
SGDYPL008W2.9995979253168707e-35CHL1 SGDID:S000005929, Chr XVI
from 539385-541970, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig246.0.g102(coding)
ATGAAGCTACAGTACGAAAAAGAAGATGACTAAGACGACGATGAAAATAGTGATTAAAGG
AACAATTAAAAAAGGAAGAGTAATGGTTCAAACGAAGGAGATGAATTGAACCTTCATAGC
TCAGGGGAGGATGAAGAAGATAGTGAAAATCAAAACAACTAGTCCAAAAATAACTTTAAT
GGAAACTATCATTAGTACGGCATTCAAAGTAACAAGAAAAATCCATATACCTAAAATAAC
TAAGCATTCAACCCTTCACTACTAAAAAATGGTTAAGGATAGAGCAGTCGATACTTTTCT
GAGTTTGCAAAGACTGATATGAAGGATGAAGAAAACAAACTTAGATATCTCAAGCATATT
GACTAGGCTTGTAAAAGGGGTTTAAATGCATTACTAGAAAGTCCAACAGGTACAGGTAAA
ACTTTATGTCTCCTGACTGCAGGTTTGGCTTGGTTAAAGAAAATAAGAGAGAGTAATGAA
GTTGACGAGAAAGATTTACCCAAGATTATTTACTGTTCTAGAACTCATTCTCAGATTTCT
CAAGTAATGAATGAACTCAAACATACTGCCTACAAACCAAAGGTTTGCCTAATTGGTAGT
AGGGATCAATTATGTGTGAATCCAATGGTGAATACTCACAAAGGCATGTCTTTAAACTCA
TTATGTAAAAAGGTAAGAGAGTAAAGGAAGGACTCTCCAAATTGCTGTTCATTCTTCAAA
AACACAGGAGACTCAGTTACTCCTAATGGATTTGAATGGGGAATTTAAGACGTTGAAGAT
TTGCATAAACTTGGGACTAAAAATATAGTTTGTCCTTATTACCTTCAAAAATCTAGAATT
AAATATGCTGATTTGATTCTCATGCCATACAATTACTTAATAGATCCAAAAATTCGAGAA
AATTTCAAAGTTGATTATGAAAACTCTATTATCATTATGGATGAAGCACATAACGTTGAA
AGGGTAGCCGAAGATGTTGCAAGTTTTGAAATTCATATAAATTAACTCCACACCGTTTTG
GGAGAACTTCATGATTTAGACAAAGATTTCAAAACAAGAGTATTAGATAAGCCAGACTCA
ACTTTGGGTCAGAATATTTATGAGATAATCACTTTGACAACAAACTTTTTGAATTTTCTT
AAGAATTACAATATTAAAGGTCCAAACCCCAGCAAGAAAGCTATTTAGGATATTAAAGAA
TCTGACGCAGTTTATGAAGGAAAAGAGATATTCAATTTTTTCTTTCAAGGATCAAGGTAC
AAGGATTATAGAAACTATAATGGACCAGAAAAGTTTGAGGGATTAACAGAGAGAAATTTT
AACCACTGGAGATATATATTTGAAAAGGTTCTAAGTGAACTATCTGAAAGGCAAAATGGA
AGGCCATGTTTAGAAAGATGGTGGGATGCTTTAAAGAAGGTCATCAGACTTTATGAAATG
ATTTATGATCCTCAAAAATCTATGTCTTCAGATCGAGAATGCTAAACTATGAGAGATGAA
ATCAATCACTATTTTGTTTACTTGAGATAAGAGGATGTTGAGTTTGATAAGAAAAGAATT
TACTCAGAGCAAGAGAAAGAAAATAGAATTAGAACGGCAAGATCTCTAGGATTTTGGTGT
TTTAATCCAGGATTAGGATTTCAAAAGATTGTTAACTTAAATCCTAGATCCCTAATTCTT
ACTTCTGGTACTCTTTATCCAATGTCTTCATTTTAGAAAGAGTTGATGATGGATTTTCCA
ATAAAAATTGAAAATAAACATGTTATATCCAAAGAGTAAGCTAGCATAAGCATTCTTACA
AACGGTGTAAAAGGCCATGAATTTAATTTTGCCCATAAATTCAGAGAAAATGAAGATTAG
CTTGACGATCTCGGAGAAACTTTACTAAGGATAACTGAGGTCACTCCAGGTGGAATATTG
ATATTCTTTCCATCTTATCAAATGTTGCATAAACTTTATGAATTATGGGAACATAGTGGA
CTTATCAAAAGATTAGAAAGAATAAAAACAGTGCTTCAGGAACCAAGAGACTCATCTCAC
TACAAATATGTAATTACGAGCTTTTACTAGTCAGTGTACACTAAAGGGGCTATAATATTT
GCAGTTTGTAGAGGAAAGATAAGTGAAGGTCTGGATTTCTCAGATGATGCAGCTAGATGC
GTTATAATTATTGGCATACCATATCCAATGACTCTGGATCCAAAAACTATTCTAAAAAAG
CATTATTTGGATAAGACTAGGAATGATGGTTTAACAGGACATACATGGTATTAATAATAA
GCTACCAGAGCTACAAATCAAGCTATAGGAAGAGTTATTCGGCATGTCTAAGATTATGGA
AATATTATACTAATTGACAAGAGATTCGATAATCATACTTAAAGGAAACAGATAACAAAT
TGGCTTAGAGATAGTGTTGTGGTATTTCAAGATGCTAAGAAAGCAATTGATAAGTACTTG
GATTTTTTCGTAGAGATGAAAAAAAGAAATTTTGTGCCAAAAGTTCAACAATTAGCATAA
GTGAAATTAGACTTTCCAGAAATTGATGATGATTTAAACTTGAAAGAAACGGTGGATTTA
TTAAAAAGCAAGGCCTAAGAAGAGTCAAATAAATAATCACTAAGAAAAAGGACATATAAT
GAAAGTGATAATCCTGGAAAGACTAACCATTTTATTAGTGGAAGCAGTTCTAATAAGACA
ATATTCATCAGAGAGACTTTTGGATTACTGAACCTAAAGAGTAAAGAAGCTGCTTTATAG
TACTCAGAAATTGAAGATATAAAGAAGGCTTTTGGAATGAAAATGTTAATAAGATTATTC
AGATAATTCTTGCAGTTGAGTTTATTGAACGAACATGCCTATAGGAAAAGATTCAGACAA
TACTTGACGATTAAAGATTAGTCATCATCAACAAAGAATCACGTTTTTATATGCAGAAAG
TTACTGGAGATCTTGTTTGAGAATACACAGAGCAATGCAGTTGATGAAGTGCAAAGTTTA
TCATATCATTCAAATGAAGAAGATCTGTAACAAACATTTTAGGAAGACTATCTTTTATTT
CTGAAAAAGTAGCTTCTTGCTTTTATGATAAAGCGTGTTGAGTCTTATCAAGCATAGCAA
GATTTCATTATTATGATAGGATCATATTTAGGGAAACAGAACTCACAAATGGATTTGCAA
CAAGAATCACAAAATCTAAGATTAGATCACGATGTTATTAAAAACCAGTTATCCCAATAG
AAAACCTATGCTCAATAAATGAATGAAAAGATAGCTCTTATGAAGCTTTAATAAATGAAT
AAAATATCCTAAAAGTAAAATAAAAACTCAAAGAATTAGAGCAAAAAGAAATAGAAAAAA
AAGAAGAATAATAGTGAGGATGAAAGTGGGGATTAGGACTCAGAAGAATACTAACCATCT
CCAAAATCCTCACAACATAGCTCCAGTCAAAATACCTTCCACTCTGATTAAATTGATGGA
AAAGAATTAAGTGACTATCAAGATGAAGAGTCTGAGCAAATCATAAGAACCTAAACTACT
AATTTAGAATAATAAGATGCCTAACTAAATCAAAGATCTAAAAAGCAAAAGCAAAATATA
ATAGATTAGGAATAGTTAGAAGATGAAAATATTGAGAATTACAACGATGAAGAGCTGGCT
TATATGCTTCAAGAATAGCAAGACCAAGAGAGATTTGTAACTGTGGCAGAGAATTAATTT
TACAAGTCTGATAAAGTAAATCCCACTGAAGCATTTATGAATGTAATTAATAGAAACAAA
TATCATTAAATTGAGGCAATTGAAGAAGATAGTAGGGATCAGTAGCGTTATAGCGAGGAA
GAAATCGAAAATGATTCGAATTAAAAATCAAAAAGAGGTAGAAAAAGTAAAAAACCACCA
AGTAAGACAAAACCTAAAACTAAAAGAGAATGCGTATCGTTTAATAGAATGTTAAACTCA
ATACCTTAAGAGAATTACAATCCTGTAAATTGTAAAAAGGAATTGTTTTAAGCACCAAAC
TCAAAATCATTTTTATCAATTGCTATGGAGCCTAAACACACAAAAGAATAAAATTCTGAG
CTGTAGAAATGGGATGCAGCTTTTTAAGAGACAAGCAACTAGTATCACCAAAAATTCAAT
AGAAGAGCCAAAAATAAAGTACAACCAAGTTTGGATGAACTTAATTCAGTTCCAAAGATA
TGTAACAGTAGTCTGTTAATGGATAACAGCCTAATTCAAAATAGTCTTATAAGATACCAA
GAGAAAAGATTGGAGACTGAAAACATTAAAAACAAGAGCAGCTTATTTTTAGATGATAAA
TAACCAACAGATTTTAAAAACATATTTTTATCGAGATACCACTGA


>Contig246.0.g102(protein)
MKLQYEKEDDQDDDENSDQRNNQKRKSNGSNEGDELNLHSSGEDEEDSENQNNQSKNNFN
GNYHQYGIQSNKKNPYTQNNQAFNPSLLKNGQGQSSRYFSEFAKTDMKDEENKLRYLKHI
DQACKRGLNALLESPTGTGKTLCLLTAGLAWLKKIRESNEVDEKDLPKIIYCSRTHSQIS
QVMNELKHTAYKPKVCLIGSRDQLCVNPMVNTHKGMSLNSLCKKVREQRKDSPNCCSFFK
NTGDSVTPNGFEWGIQDVEDLHKLGTKNIVCPYYLQKSRIKYADLILMPYNYLIDPKIRE
NFKVDYENSIIIMDEAHNVERVAEDVASFEIHINQLHTVLGELHDLDKDFKTRVLDKPDS
TLGQNIYEIITLTTNFLNFLKNYNIKGPNPSKKAIQDIKESDAVYEGKEIFNFFFQGSRY
KDYRNYNGPEKFEGLTERNFNHWRYIFEKVLSELSERQNGRPCLERWWDALKKVIRLYEM
IYDPQKSMSSDRECQTMRDEINHYFVYLRQEDVEFDKKRIYSEQEKENRIRTARSLGFWC
FNPGLGFQKIVNLNPRSLILTSGTLYPMSSFQKELMMDFPIKIENKHVISKEQASISILT
NGVKGHEFNFAHKFRENEDQLDDLGETLLRITEVTPGGILIFFPSYQMLHKLYELWEHSG
LIKRLERIKTVLQEPRDSSHYKYVITSFYQSVYTKGAIIFAVCRGKISEGLDFSDDAARC
VIIIGIPYPMTLDPKTILKKHYLDKTRNDGLTGHTWYQQQATRATNQAIGRVIRHVQDYG
NIILIDKRFDNHTQRKQITNWLRDSVVVFQDAKKAIDKYLDFFVEMKKRNFVPKVQQLAQ
VKLDFPEIDDDLNLKETVDLLKSKAQEESNKQSLRKRTYNESDNPGKTNHFISGSSSNKT
IFIRETFGLLNLKSKEAALQYSEIEDIKKAFGMKMLIRLFRQFLQLSLLNEHAYRKRFRQ
YLTIKDQSSSTKNHVFICRKLLEILFENTQSNAVDEVQSLSYHSNEEDLQQTFQEDYLLF
LKKQLLAFMIKRVESYQAQQDFIIMIGSYLGKQNSQMDLQQESQNLRLDHDVIKNQLSQQ
KTYAQQMNEKIALMKLQQMNKISQKQNKNSKNQSKKKQKKKKNNSEDESGDQDSEEYQPS
PKSSQHSSSQNTFHSDQIDGKELSDYQDEESEQIIRTQTTNLEQQDAQLNQRSKKQKQNI
IDQEQLEDENIENYNDEELAYMLQEQQDQERFVTVAENQFYKSDKVNPTEAFMNVINRNK
YHQIEAIEEDSRDQQRYSEEEIENDSNQKSKRGRKSKKPPSKTKPKTKRECVSFNRMLNS
IPQENYNPVNCKKELFQAPNSKSFLSIAMEPKHTKEQNSELQKWDAAFQETSNQYHQKFN
RRAKNKVQPSLDELNSVPKICNSSLLMDNSLIQNSLIRYQEKRLETENIKNKSSLFLDDK
QPTDFKNIFLSRYH