Identifiers and Description

Gene Model Identifier

Contig21447.0.g90

Standard Name

RTEL1a

Aliases

Contig21447_0_g90

Description

Helicase C-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006844909.00055006962023e-115DNA repair helicase (rad3)
SGDYER171W2.0006622580855403e-35RAD3 SGDID:S000000973, Chr V f
rom 527082-529418, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21447.0.g90(coding)
ATGAAAATAAGCTACGAGAATTCAGACGATGAAGATAGCTTTATGCCTGATCTAAACGAT
TCAGACTTGGAAGATGCCCTATTCTCTAAAAACAACAACAGCCTCGACAACACAAAAAGT
CGCAAAGTTTCAGGAGATCAATAAATACAGAATAGTAATTAAAGTCCATTTATCACTGCA
AAAAGTCATCTTCTCAACAAAAATGGGAATGGTGAAACTAAGCCATCAATTAGTGAATTC
TTCAGCAAACGTAAATCAAACAATGATGATCACTTTGACTATGGTGCTTTGGAAACTCAA
ATCTAAAAAAGGCAATCTACATCTAAAGCTAATGTTTCTCAATCGAATGAGGTATGGATT
GATAAGAAAACAGGGAAGTAGGAAGTTTAGAACAAGTATTTCAATAATGTAGTGAAAAAT
GATCAGTCAAATTTAAACTAGAATAGTAATGCACAATCTTCAGATGGAAGCAGAAACTTC
AACATGAAGGAATTGTAGAGTTAACTCGAGTCTAACTCTCAAACAAAAAGTTAAAATCAT
GATGATTATGAAAAAAATTATCATTAGAAGATAAACCCATTAAAGCCAAAATCAACTGAG
CAATTGAATTTCTAGAATGATAAAGAATACGAGCTGAATGACTTGATTGACATACAAGAA
GAAGTCAAAGACCCAGGATAAGATAAAAAATCATATCGTCATGATATTAGCAATGTCTTT
TAAAATAAGGGAACTGGTAATCGTTTTGGAATAAAAGAAGCTGGAGGAAAGATTCAGCTA
TAACCTTCACCAAGAATTGAATATAAATCCAACGAGATTTTGAATAGGCAATTTCAATTT
CAGACAGATGGACATACGGTATACTTCCCCTTTAAGCCATATTCATGTCAAGTTGATTTC
ATGAGTAAAGTTATCAAAGGTTTGAATCAAAATGAAAATGCACTGCTTGAAAGTCCCACA
GGTACTGGTAAAACTTTGAGTTTGCTGTGTGCTTCACTTGCATGGCTGAAATTATAAAGA
GAAAAAGTTGGCATTCAATCTGGTGATGTTCCAAGAATCATATACACTTCTAGAACACAT
TCACAACTTGCTTAAGTGTAAAAAGAACTGAGAAATACTGCTTATAATCCAAGATCTGTA
ATTTTAGGCTCAAGAGACCATCTATGTGTTCATCCTGAAATCAAGCTTCTAAGAGGAAAT
GCCTTAAATTTAGCTTGCTAAAAAGCTCAAAAGGCTATAGATCCATGCATCTTTGGAAAG
AATCGTGACATAGCTCTTACTAAACTTTCATGGGAGCCTTATGATATAGAAGAGCTTCAT
GAAATTGCAACAAAGATGATATTTTGTCCATATTTTGCAAGCAAAGATAGAATGCAAGGT
GCAGACGTCATTTTTATGCCTTATAATTATCTTATTGATGACAAAATTAGAGAAAATTTC
GATATTAACTACAAGGGCTCAATCATTATATTTGACGAGGCACATAACGCTAGTAGTACA
GCTGAAGATGTTGCCAGTTTTGAATTAAACACTAAGCTCCTTGAATAATCAGAATTTGAA
CTACAAAAACTTTAAGATGAGAGGAGACTACGTGGAGATGAGTTCACATTTAAGTCAAAC
GATGAAGATACTCAAAATTTAATGTATATGACAAAGAAATTTAGAGAGTTTATAGATAAT
TATGAACTTGACTAGACTTAAGTAAAAAATTTCAGAGTTGATAAGCAATACCTTAAAGAC
GCTTCTGTGGTCATGCCTGGAAGAGAAATATTTGAAATTTTCAGAAAGGGAACTGAATTT
TAATGTTTGGACAGAGTTAATCAACAATCAAAGATGACGAATATTTTTTCTGAGTGGGGT
AGATGGCAGCAAGCTTTCGATAACATTCTAAATGATATCCAAACTCTTCAACAAGCTACC
ACAAAACTATAACTAGACATTTGGTATGATATTGTCAAGAGAGTATCAAGACTAATGAGA
AAAGCTGTGCAAAAAAAGAAAAATCTAGAACAAAACCCTGGTTAATCTAAGGCATAAGAA
ACTACAGACGATGTTGACGACTTCTATATTTACTTATTTGATGAAGAAGATCAATAGAAT
GATTAATTGACTTTCAACATGAAGAAGAAAAGGAACAATAGAGATGTTTTTGTACAGAAA
AATTGGATGAGAAAGCTCTCGTTTTGGTGTTTCAATGCTGGAATAGGTTTCAGGGAAATT
CAAGAATTACTTCCAAGATCAATTATATTGACATCTGGTACACTAAGTCCTCTGAATTCC
TTCTAAGCTGAGTTGTAGATCTAATTCAATCAGAGACTTGAAAATCCACATGTTATTAGT
CCAGAATAAGTTTCCATTAATATCCTGACAAAGGGGGTGAGGGAATCGCTCTTCAATTTT
TCTTTTAACAACAGAGATAACGAAAATACTATGGTAGATTTAGGTATGAGCATTGCTAGT
ATTGCATAAGTCACTCCAGGAGGAATGCTTGTATTTTTTCCATCATATAGAGTGATGTAG
AGATGTGAGGAAGTTTGGAATAATTAGAAAGTCAGATAGCATATTGAAAAGCATAAGAAA
CTGTATATGGAGCCAAAGGATCCATCATAGTATCAAACTACAATGGACCTTTATTACAAG
TCTATTTTCAGTCCAAAGCCTACTGATAAAACAAATGGTGCAATCTTAATGGGAGTTTGC
AGAGGAAGAATATCTGAAGGTTTAGATTTCTCTGATAACGCAGCTCGCTGTGTTATAGTA
GTAGGCATCCCCTACCCTCAAATGACAGATGCCAGAGTAATCTTAAAGAAGGATTATTTG
GATAAACGTCTCAATCAACAAAGTAGAAATAAGAATAATCAATACCCTCCATTATCCGGT
AAAGATTGGTACTCTCAGTAGGCTACAAGGTCTGTTAACCAAGCTATAGGGCGTGTGATT
CGTCATGTCTAAGATTACGGATCCATAATCTTAATTGATGAGAGATATAACTGGGGAACT
ATGAGAGGCTAGGTATCCAAATGGCTTAGAGATCGCATAAAACTGCACAATAAATGTTCT
GATATGTAGAATGAAATGAAGAGCTTCTTTGAAGAAATGAAGACCAAAGGTTTTAAAGCC
AAAGTCGAACAGCTTGGCCAGTTATAGATTGAGTTAGAAACTGAGGATGGGAAAGCTAGG
AAACAGTAAAACACTTAGAACTCGGATGACGATGAAGCAAAAGGTAATGGCCTGGGCTTT
ATGCATAAAATAGGCAATAAGAAATAGGAAGTCGAGGAGTAAAAGACTTCAGCAGTTGTA
GATAAGAAATCAGTAGCTAGTTATTTCTAGAAAGCAAAAGATGTACCTATCAAGAATTAA
ATGCAAAAGAGGACTCTTGCTGATGTTGAAGAAAATAATAGTGCGAATGTTGGTAGATAG
GTTATAAAATCTAAGAAAGGAGCTAAGTTTAATCAAGGTAACAACAAATTGGGTTACTGC
GATGATGATGAAGAGGAAACAATAGCAGATTCTGATAAAGCAATTACTCCCCAACAACAT
TTTATTAACCCTCAAGATCAACCATCTGACATTTTCGGACTTAAGAACCGCCATGAAAAC
AAAACTGAGTCATAATTTGATAGATTGAAAAGTTTCTCATATGATCCAAGTAAAAAGAAC
ACGAAATCTGATACTTCTGCCAATGCCATAGAATAAACTAAAAGATTACCCTCTAAATCT
CCTAAGAAAGCAACTACTGTATAAAAAGGAGAAATGATCAAATAGCAAAGCAAAACAGCT
ACTTCGAACGATTCTGATAATATAGAAGAGTCACATCCACAAATATAAAATGATAAAGAC
GTCAGGTAGACCAGACAGTAAGCTATCAATTCACTAAATGCAAGTTCTATGCGTACTGGT
GGAAGTAAAGCAAGTGAAAGTACTTAGATAAATAGCGGTCTATATTCTAGTGATAGTTAA
GCCATCTAAAATAAATAGCAGAAGAATATTTAACTGATAGAAGGTTTCAAAAGACTGCTG
GGTCATGACGAATTGAAAATAGTGGTAGAAATAATAAAAGATATAAAAGCATGTAACAAC
CTTCAACCAGTATTCCAGAGATTAAGAGAAGCCATGTTTGGTAAGATAAAAGATATCACA
ATTGATAAGAAATTTGGAGAGAAAATGCAATTAATTTAGAATCTGGGATCGTTTATACCA
GCTAATAAGAAAGCTGAGTATGACAAGCTGCTCTAATCTATTTCATGA


>Contig21447.0.g90(protein)
MKISYENSDDEDSFMPDLNDSDLEDALFSKNNNSLDNTKSRKVSGDQQIQNSNQSPFITA
KSHLLNKNGNGETKPSISEFFSKRKSNNDDHFDYGALETQIQKRQSTSKANVSQSNEVWI
DKKTGKQEVQNKYFNNVVKNDQSNLNQNSNAQSSDGSRNFNMKELQSQLESNSQTKSQNH
DDYEKNYHQKINPLKPKSTEQLNFQNDKEYELNDLIDIQEEVKDPGQDKKSYRHDISNVF
QNKGTGNRFGIKEAGGKIQLQPSPRIEYKSNEILNRQFQFQTDGHTVYFPFKPYSCQVDF
MSKVIKGLNQNENALLESPTGTGKTLSLLCASLAWLKLQREKVGIQSGDVPRIIYTSRTH
SQLAQVQKELRNTAYNPRSVILGSRDHLCVHPEIKLLRGNALNLACQKAQKAIDPCIFGK
NRDIALTKLSWEPYDIEELHEIATKMIFCPYFASKDRMQGADVIFMPYNYLIDDKIRENF
DINYKGSIIIFDEAHNASSTAEDVASFELNTKLLEQSEFELQKLQDERRLRGDEFTFKSN
DEDTQNLMYMTKKFREFIDNYELDQTQVKNFRVDKQYLKDASVVMPGREIFEIFRKGTEF
QCLDRVNQQSKMTNIFSEWGRWQQAFDNILNDIQTLQQATTKLQLDIWYDIVKRVSRLMR
KAVQKKKNLEQNPGQSKAQETTDDVDDFYIYLFDEEDQQNDQLTFNMKKKRNNRDVFVQK
NWMRKLSFWCFNAGIGFREIQELLPRSIILTSGTLSPLNSFQAELQIQFNQRLENPHVIS
PEQVSINILTKGVRESLFNFSFNNRDNENTMVDLGMSIASIAQVTPGGMLVFFPSYRVMQ
RCEEVWNNQKVRQHIEKHKKLYMEPKDPSQYQTTMDLYYKSIFSPKPTDKTNGAILMGVC
RGRISEGLDFSDNAARCVIVVGIPYPQMTDARVILKKDYLDKRLNQQSRNKNNQYPPLSG
KDWYSQQATRSVNQAIGRVIRHVQDYGSIILIDERYNWGTMRGQVSKWLRDRIKLHNKCS
DMQNEMKSFFEEMKTKGFKAKVEQLGQLQIELETEDGKARKQQNTQNSDDDEAKGNGLGF
MHKIGNKKQEVEEQKTSAVVDKKSVASYFQKAKDVPIKNQMQKRTLADVEENNSANVGRQ
VIKSKKGAKFNQGNNKLGYCDDDEEETIADSDKAITPQQHFINPQDQPSDIFGLKNRHEN
KTESQFDRLKSFSYDPSKKNTKSDTSANAIEQTKRLPSKSPKKATTVQKGEMIKQQSKTA
TSNDSDNIEESHPQIQNDKDVRQTRQQAINSLNASSMRTGGSKASESTQINSGLYSSDSQ
AIQNKQQKNIQLIEGFKRLLGHDELKIVVEIIKDIKACNNLQPVFQRLREAMFGKIKDIT
IDKKFGEKMQLIQNLGSFIPANKKAEYDKLLQSIS