Identifiers and Description

Gene Model Identifier

Contig7653.0.g61

Standard Name

RTCBb

Aliases

Contig7653_0_g61

Description

Uncharacterized protein family UPF0027

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01139 ) Uncharacterized protein family UPF0027

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7653.0.g61(coding)
ATGAATTCCCAGATCTGCAAGTAGTAATTCATTTAAGACGAAGAATCTAAGCTAGAGAAA
TAAGTATGGGTACATAGGAAAGGAGCTACTCCCTCAAATCGCTCAGAATTCCTGGTGATT
CCAGGTTCACGAGGTTCTTACTCTTACCTAGTGAAAGTTAATAAAGAAAATACACATTTA
TCAGGGTACTCGTTGGCTCATGGAGCAGGTAGGAAGATGAACAGAAAAGCTCCCACTGCT
TACAAAAACATAGACTCTGTGGTAAGAGACTTAGTTGAATTTTAGTTGGTAACTATCGTT
GCCTAATTGAAACCCCTGCTAACTTATAAATTCAAGGAGCCTGGATTCGGCAATTCAAAT
TTGAAACACAGATACGACTCTGCTCTTCATTGCAGGAAGAGATAAGAGAAAGAGTAAGGT
GTTTCATAATAACAAAACGATAATCAATAGTAGTGA


>Contig7653.0.g61(protein)
MNSQICKQQFIQDEESKLEKQVWVHRKGATPSNRSEFLVIPGSRGSYSYLVKVNKENTHL
SGYSLAHGAGRKMNRKAPTAYKNIDSVVRDLVEFQLVTIVAQLKPLLTYKFKEPGFGNSN
LKHRYDSALHCRKRQEKEQGVSQQQNDNQQQ