Identifiers and Description

Gene Model Identifier

Contig3020.0.g30

Standard Name

RTCAa

Aliases

Contig3020_0_g30

Description

Gag protein p15

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009742700.00000000000004998767099442072hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3020.0.g30(coding)
ATGACACATTTACCTATGGCAAACCAGAAATAAGAGATCCAGAAAATGCAGGCTAAAAGA
AGCAATAAGAAAGAGAGCAACAACTGCAAATGTAACTACATCCATTTATTAATTGATGTT
TAGAAATAATACGCTTTCAGAAAAGAATAAGACATAAGATTAAGAGAGCCATCAGGTGCT
GTATTAAAAGCAATGAATAAGTCAATCAGATTACCAGATGAAAGTTTCACTTATGGCAAG
GCATTGAGACCTTCAACCCCAATTAAAGATGTAGTCTGCAATTTCTACTCAGATGTAGCT
GAGCAAGAAATGCTAAATAGATATGATTATATAAGAGCACAATCAAGATCAGGGCCAAGG
CTTAATTGTTACGAAAGACACACAAAGGCATCAGCACTTGCTAAGGATCATGTTCAATCA
AGATAAATCCAAGATAACTCTATCATTACTGGAAATAATACATTATTCAAAATGAGGAAA
TTCCTTAATGTACAGCCTAGAACAAATACAAATATGGGTAAAAGACCTGCAAACTTAAAC
AAATCAGCAATCGTATCAAAGTACTGA


>Contig3020.0.g30(protein)
MTHLPMANQKQEIQKMQAKRSNKKESNNCKCNYIHLLIDVQKQYAFRKEQDIRLREPSGA
VLKAMNKSIRLPDESFTYGKALRPSTPIKDVVCNFYSDVAEQEMLNRYDYIRAQSRSGPR
LNCYERHTKASALAKDHVQSRQIQDNSIITGNNTLFKMRKFLNVQPRTNTNMGKRPANLN
KSAIVSKY