Identifiers and Description

Gene Model Identifier

Contig8790.0.g76

Standard Name

RSP1

Aliases

Contig8790_0_g76

Description

Nuclear RNA-splicing-associated protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10500 ) Nuclear RNA-splicing-associated protein

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8790.0.g76(coding)
ATGGTAAAAACTTAAGCAAAGGCCCCTGTTTCAGCTTTCATTCAAAGACCATTGACTAGA
GCTATTCACAAGCAACACAATAACCCTGATATTTCTCGTTCTTCCATTGATGAGTGCTAT
GAACCTAATTTGAGAAACACTTCTATACAATCTGCTTTTGTGAAATCTTCTGCTTCTACC
AGAAATAAGCAAAAGCACAATTCTGATAAGAAAACTTTAAAAGTGGCTTCATCAATTGCT
AGTTCTGTCAACCAGTCTATCCTTTCTTCTTCTGCAGCTCTTAACTAAGGTAGGTAGATG
ACAACAAGAGGACAGAGAGGCAATACAAACAACAAGCATGATAAAAACAAGAAAGCCAAA
GCCCCTCAGAAATCTTTTGAGGAAGTGGTTTAGACTTTGAATGAGTGTGACTAGTTCAAA
GCGAAGAGTATGATGAGTATGGTGAAGATCATTGAGTAGCATCCACATAGTTTTATGTTT
GACTTCATCGACTAAGATAAAGAGTTAACTCTCCAGGATATCAAGCAAATCATCACTCTA
AGTGCTAGTAGTATTGATGATGCCACTCAAGATGCTAACTCAAAAGCCAAGGATGATGAT
GAGAGCTTAGCCCTTGAACATAGAGTAAAAGACTTTGAACATTTGGAACTCTTAGTAATG
AAGCTATTTGATGGAATGGAAACCACTTTCAGTGACTTGCATGAATAGATACTTGAGTTA
GTAGAAGCAGACAAAAAAGAGTTTGTTTGTGATGGAGAAACTATACAAACTATCTTCAAT
GGTTTATAGAAGATTAGTGACTCAGAGAAAAATTAATTGCTTGATACTCATTCAGTATTT
AGATTCGACAATGGTACCTAGTTATTGGACTTTATTCCTGAGAAGGCTGATGAAGTTATC
GATCTAACTAGAAAACTAGAGACTTTGATGCTTAAGAAATAATAAGGATAGTAATGA


>Contig8790.0.g76(protein)
MVKTQAKAPVSAFIQRPLTRAIHKQHNNPDISRSSIDECYEPNLRNTSIQSAFVKSSAST
RNKQKHNSDKKTLKVASSIASSVNQSILSSSAALNQGRQMTTRGQRGNTNNKHDKNKKAK
APQKSFEEVVQTLNECDQFKAKSMMSMVKIIEQHPHSFMFDFIDQDKELTLQDIKQIITL
SASSIDDATQDANSKAKDDDESLALEHRVKDFEHLELLVMKLFDGMETTFSDLHEQILEL
VEADKKEFVCDGETIQTIFNGLQKISDSEKNQLLDTHSVFRFDNGTQLLDFIPEKADEVI
DLTRKLETLMLKKQQGQQ