Identifiers and Description

Gene Model Identifier

Contig956.1.g20

Standard Name

RSL1D1

Aliases

Contig956_1_g20

Description

Ribosomal protein L1p/L10e family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005852907.00293386439118e-45hypothetical protein
SGDYHR052W0.0000020007268868677913CIC1 SGDID:S000001094, Chr VII
I from 210848-211978, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig956.1.g20(coding)
ATGGTAAAAAAGGTAAAGAACCAACCCAAGGAAGAAAAGCCCCAAAACAAGTCAGATCTA
AAGGAGCAAGAGGAAGTTAAAGAGATAACTGAAGCTCAAGCACCATAAGACCCAGAAGAA
TCATTGACAGTATAGGAGAAGAAGGCAAATGCAAAGAAACTCTTAAAGGCAATAAAAAAG
ACTGATGCTAAAATTAAGAGCTCCATCGACAAGAAGCAAGTCATTAAGGCTATTGAAGCA
CTCCAATCATATCAAAAGGGATAAAAGTCACAGAATATTACTAAGAAACTTTTAGAGGAT
GAGGATAGCTTTGTGCAAGTCAACTTCACTCTTACTCAAGTACCAGTCAAGCCTACTCCA
AGACCTTAACAGATAAACATTCCTCACCCCTTTAACTCAAAAGAAAACAATACCAGAGTA
TGTTTGTTTGTGAAAGATCCAGCAAGAGAAATTAAAAACCAATTAGCAGAGCTTAAAATT
CCATGCATTGCAAAGGTGATTGGCTACGATAAGCTAAAGAAGAATTATAGACAATTCAAG
GAAAAGAGAAAGCTTCTTCAAGAGTATGATCAATTTTTGGCAGATATTAGAGTATACAAG
ATGCTTCCAGAGCGCTTGGGAAGAGAATTCTACGATAAAAAGAAATACCCTTGCCCCATT
AAGATTCACGGACATGCTGAACCAAAGGAATTACAAAAGACATTAAATAAGGCAGCTCAA
GCTACATATTTCATTCAAGGAAATGGGCCAAACTACTCAGTTAAAATTGGAAGAACTTCT
CAAGACTCTAAGAACCTCGCAGATAATTTTGAAGCAGCTTTAAGTCATGCTATTGCTTAT
GTAACTTATCACGAAGATATTAAATTCTCCAAGATATCATCAGTCTCTATTAAAGTTGGC
GAGTCACCAGAGCTCCCCGTTTTCAATCAACTAACTTAAACAGAAGTCTTGGCATTCTTA
AATCAATGA


>Contig956.1.g20(protein)
MVKKVKNQPKEEKPQNKSDLKEQEEVKEITEAQAPQDPEESLTVQEKKANAKKLLKAIKK
TDAKIKSSIDKKQVIKAIEALQSYQKGQKSQNITKKLLEDEDSFVQVNFTLTQVPVKPTP
RPQQINIPHPFNSKENNTRVCLFVKDPAREIKNQLAELKIPCIAKVIGYDKLKKNYRQFK
EKRKLLQEYDQFLADIRVYKMLPERLGREFYDKKKYPCPIKIHGHAEPKELQKTLNKAAQ
ATYFIQGNGPNYSVKIGRTSQDSKNLADNFEAALSHAIAYVTYHEDIKFSKISSVSIKVG
ESPELPVFNQLTQTEVLAFLNQ