Identifiers and Description

Gene Model Identifier

Contig19604.0.g67

Standard Name

RRS1

Aliases

Contig19604_0_g67

Description

Ribosome biogenesis regulatory protein (RRS1)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005942208.00089003463867e-30ribosome biogenesis regulatory
protein (RRS1)
SGDYOR294W9.99946582325553e-18RRS1 SGDID:S000005820, Chr XV
from 868340-868951, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19604.0.g67(coding)
ATGACTGAAGTAGTAAATGCACTTAATGGGGCAACGCCCATGGCATCCCTTTACCCAAAT
CTTGAGCAAGGAAAGGCTGTAGGAGTCAACAAATACTGTGATATTGGAGCTCTTATGTTC
GAAGACTGTTCTAGTTATACTGACAAGAAAGAAAAACAGATATTAGATGACACTAAGAAA
AACTTATGCATCCTCTACAAGGAATTATTCGATTTGAAGAGAGAGCAGGTTAATGCTTTA
GGAGAAGATGGTGAAATTCTTGAACATACCAGATCCATGTTTAGCGTACTCTTGCCACCT
CCAAGAATAGTGACTCCAAGAGAGAAGCCAATTCCTAAAGAAAAGCCCATGACTAAATGG
GAGAAATTCAGACTTGAGAGAGGTATGACGGTCCGTAACAAGAGATCCAGATTAGTTTTT
GACGAAATCACAAATGACTGGGTACCTAGATGGGGACATAACAGTAAGAAGAAGATTGAA
GAGTCACATAACTGGCTTATGCTTGACAAGCCAAGCAATGAAGGCACAAATCCATTCACA
AAGCTCAAGCAAGAAAAGAGAATGAATCTTGAGAAGGAAAATCTTAAGCGCATGAAAAAT
GAGGTTTACGCAGCTAAATAGATGAAAGGAGCAAAGAATGAGGGATAGAGCACTCAAGTC
CTGCCTCAAAAAGAAAATGGAAATGCAAAGGCTGATCATGATCTAGATAGACAGGCTGTT
AAAAAGAGAGAGCGCAAATCACTCGAGAAGAGTTTCCAACTTGCTCAACTAAGTACTGCT
TCAATGGGAAAGTTCGACAGAAAAATCAGCAAGAAAGAACCAGATGCTCCAAATTCACAA
AAGATCTTAAAGAAGAAGAGCAACTCTCAAATGGCTGAAATGGAAAGAAATCCCAGAGTT
GAAAAAGAGAGAAGTCTCAAGATTCTCGGATGGATGCAAAAGTCAGAAGAAGTTTAACAC
AGAACAAAAGCTGATGCTCATTTAGTTAATGCAGACAAAGTTGTCCAAAACACAATCAAA
AGAAAGGAAAAGAAGAGATCAAAGGGAAAGAATTGA


>Contig19604.0.g67(protein)
MTEVVNALNGATPMASLYPNLEQGKAVGVNKYCDIGALMFEDCSSYTDKKEKQILDDTKK
NLCILYKELFDLKREQVNALGEDGEILEHTRSMFSVLLPPPRIVTPREKPIPKEKPMTKW
EKFRLERGMTVRNKRSRLVFDEITNDWVPRWGHNSKKKIEESHNWLMLDKPSNEGTNPFT
KLKQEKRMNLEKENLKRMKNEVYAAKQMKGAKNEGQSTQVLPQKENGNAKADHDLDRQAV
KKRERKSLEKSFQLAQLSTASMGKFDRKISKKEPDAPNSQKILKKKSNSQMAEMERNPRV
EKERSLKILGWMQKSEEVQHRTKADAHLVNADKVVQNTIKRKEKKRSKGKN