Identifiers and Description

Gene Model Identifier

Contig11865.0.g86

Standard Name

RRP9b

Aliases

Contig11865_0_g86

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam08801 ) Nup133 N terminal like
  • ( pfam10433 ) Mono-functional DNA-alkylating methyl methanesulfonate N-term
  • ( pfam11715 ) Nucleoporin Nup120/160

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004495703.998648822114894e-70hypothetical protein
SGDYPR137W3.998395524589391e-34RRP9 SGDID:S000006341, Chr XVI
from 802359-804080, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11865.0.g86(coding)
ATGCAGCGAAGCGGAGGAAAGTTTGGCAAGTCCACTCTCTCGAAATAAATCTCAAAGATA
AAGACTCAAAAAGCCAATGACAAGACTAAAAAGATGGGTAAAGCAGCAGCTGGTGCTGGC
GGTAAGAACAAAAATAGCTCTAAGATTGGAGAAGCCACAGCCAAGAAAATGATGAACAAA
GTTAATGAGAGGAAAGAGAAGCGCAGAAGCAAGACCATGGAAGAGGAAATCGATAGTGAT
ATTGCTGATGATATCGACATGCAAGAAGAAGGTGATGATAAACAATTCAAGAATGCTGGT
GGTGCACTCTCTAGTGATCCATTCTTTGCTCAGTCTACTGAGGATTAAAATGAGACAGTA
GAGGAACGTAAAATGAGAATGACCAAATAACTATTGCAAGAGTTGCAAGCTCCAGATGCT
TAACAGAATGATTTCTTTGAGACTCTGCAGACAAAAGGAGAGGCTGAGGCTCAAATTTTC
GATAAAGACGATGACATATTGACACGTAGATTGAAGTACCAGATCTTAGAGAAAAAGGGC
AAATTATTCTACAATATCGCCAATGACTTTGCTGGAGAAGGAGCAGGAGAGTTCGAGAGA
ACTTTCTTGAAGGGACATAAGAAAGCCATTACTGCACTTGAGTGGAGCTCAGATAATAGG
TCATTGTTTACTGCATCAAAAGACTGCAATCTCATTCAATGGGATCTTGAGAGCTAGAAG
AAGTTGTTCTTTAAGGGCGATAAACACAATAGAGCAATTCAAGGGCATTACGATGAACCA
TTATGTCTAGCAGTGTCTCCTAATGGAAAATACTTAGTGAGTGGTGGCAAAGATAGAATA
GTAAGAGTCTGGGATATTCACAATCAATAATAAATCCAAACATTCATGGGCCATAGAGAT
TCAATCACTAGCATCAAATTTGATAGAGAAAATGATTAATTCTACACAGTATCAAACGAC
AGATCCCTTAAAGTTTGGAATATCAGGGAAATGGCTTATATGGACTCTCACTATGGTCAC
TAGAGCGATATATTGGGCATGGATAGTTACTCAACTGATAGACTCCTAAGTTGTGGATTA
GATAGATAAGTTATTTTCTGGAAGATTAATGAAGACTCTGAGTTGCTATACAAGAACGAG
AAACATACAGTAGACACAATTAACGTTATTAACAGTTAGTATTTCGTGACTGGGTCAAGT
GATAATTGCTTAGATTTATGGGTCATGAATAAAAAGAAGCCTATTTTCACTTTAGAGAAG
CCTCATCAAGACGATTCATGGGTTCTTTCAACTGCTAATGTTAGAAATAGTGATTTGCTT
TGCAGTGGTTCATACGATGGTTAACTAGTATTCTACAAATTCAATAAAGAAGAGAAGAAG
CTTGAAGTTATCAGAAGAGAAACTGGATTGGAAGGATGCCTGAATAACTTGAAATTCTCG
AATGTGAGAGGAAACTAATTCAACTAAACTATGTTGGCAGTGACTCACAGCAAGGACGAG
AGATTGGGAAGGTGGCACGTACAACCCAAGATCAAGGATGGCATCACTATACTCAGAAAG
ACTCAATGA


>Contig11865.0.g86(protein)
MQRSGGKFGKSTLSKQISKIKTQKANDKTKKMGKAAAGAGGKNKNSSKIGEATAKKMMNK
VNERKEKRRSKTMEEEIDSDIADDIDMQEEGDDKQFKNAGGALSSDPFFAQSTEDQNETV
EERKMRMTKQLLQELQAPDAQQNDFFETLQTKGEAEAQIFDKDDDILTRRLKYQILEKKG
KLFYNIANDFAGEGAGEFERTFLKGHKKAITALEWSSDNRSLFTASKDCNLIQWDLESQK
KLFFKGDKHNRAIQGHYDEPLCLAVSPNGKYLVSGGKDRIVRVWDIHNQQQIQTFMGHRD
SITSIKFDRENDQFYTVSNDRSLKVWNIREMAYMDSHYGHQSDILGMDSYSTDRLLSCGL
DRQVIFWKINEDSELLYKNEKHTVDTINVINSQYFVTGSSDNCLDLWVMNKKKPIFTLEK
PHQDDSWVLSTANVRNSDLLCSGSYDGQLVFYKFNKEEKKLEVIRRETGLEGCLNNLKFS
NVRGNQFNQTMLAVTHSKDERLGRWHVQPKIKDGITILRKTQ