Identifiers and Description

Gene Model Identifier

Contig18869.0.g74

Standard Name

RRP8

Aliases

Contig18869_0_g74

Description

Hypothetical methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYDR083W6.998837695286184e-44RRP8 SGDID:S000002490, Chr IV
from 612073-613251, Genom...
T. thermophilaTTHERM_000852508.997878368889416e-41hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18869.0.g74(coding)
ATGGACTTATTCAGGAAAAAGAAAAACAAAGACATAAGCCAATAAAACAAACCCGATTAG
GTTTAAAGCTAACATAATCCTAAGAAGTAAAACCCAGAAATTACCTCAAACAATCAGTAA
ACACATAAAAAGAGAGATGATAAAAACCAGAATAAAAAGCACAAGAAACAACACATTCAA
GAGAATAAGCATTAAAGCCAACATCATCAATAATAGCCAGACAAAAATGAGAATACTTAG
TATACTAAAAAAAGCAGCAATGATTCAGGGTAGTTTAAATATGACAGCAACAAGGACAAA
AACAGAGTTGTGAATAAAGTGCAGGAGGGCATGATGAGTTCGAAATTCAGGTATTTAAAC
GAGCAATTATACACTAATGAGAGTAAAGAGGCTCTCAAAATGTTCACAGAAAACCCAAAA
CTATTTGAAGATTATCACACAGGGTACAGAAATTAAGTGGATAAGTGGCCAAAGAACCCA
CTAGATATCATAATTGATGAATTGAAGAAAGAGAAATATCAAAACATGAACATTGGAGAT
TTCGGATGTGGAGAAGGTAGACTTCAAGTTGATTTGAAGGCTGCAGGACACAAGGGCAAA
ATCTTCAGTTTTGATGCCGGCAAAATGAGTCCACATATTATCCAATGTGATATAGCTAAT
GTTCCTATGAAGAATTGCTAACTAGATGTAGCGATATTTAGTTTATCATTAATGGGAACT
AACTTTCCATATTTCTTAAAGGAAGCCAACAGAGTTCTGAAGCATGGTGGTAAGCTTTTC
GTGGCTGAAGTTATGAGTCGATTTACTGATATCAATGAATTTGTTAACAAAATGCAGACA
GATGTGGGGTTCTAATCTCTAAAAGTAAACAAACTCAAGGATTTCTTCTATGTTATGGTG
TTTGAGAAAGTTCAAGATGCTCATAAATTAGTGATAAATTATGATTTTGCTGAACTTCTA
AGTCCTTGTAAATACAAAAAGAGATGA


>Contig18869.0.g74(protein)
MDLFRKKKNKDISQQNKPDQVQSQHNPKKQNPEITSNNQQTHKKRDDKNQNKKHKKQHIQ
ENKHQSQHHQQQPDKNENTQYTKKSSNDSGQFKYDSNKDKNRVVNKVQEGMMSSKFRYLN
EQLYTNESKEALKMFTENPKLFEDYHTGYRNQVDKWPKNPLDIIIDELKKEKYQNMNIGD
FGCGEGRLQVDLKAAGHKGKIFSFDAGKMSPHIIQCDIANVPMKNCQLDVAIFSLSLMGT
NFPYFLKEANRVLKHGGKLFVAEVMSRFTDINEFVNKMQTDVGFQSLKVNKLKDFFYVMV
FEKVQDAHKLVINYDFAELLSPCKYKKR