Identifiers and Description

Gene Model Identifier

Contig19665.0.g106

Standard Name

RRP7L

Aliases

Contig19665_0_g106

Description

Ribosomal RNA-processing protein 7 (RRP7)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12923 ) Ribosomal RNA-processing protein 7 (RRP7)
  • ( pfam12456 ) Inositol phosphatase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001313600.00000000000009996062864481225hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19665.0.g106(coding)
ATGTAAAAGCCTCAATAGTAGTAATCTAACCTCGGGAAGAGGCCTTAAACCACTCAATCA
CAATTGCAGTCTCAAATTCAAAAATAGAGATAAAACCCCAATACCCCCACAGCTGCAATT
AGTAGTACTAGTGCTTAGGTCAAATAAAATTCATAAGTTTTAGGGAGTGCCTCGTCTGAA
TATAAAATACTTAAAATTCCAATTACTAAAGATAAGATAGTGTTTTACTATTACAGGAGA
TATACTTAGAAAAGCACTGCCGAAACTAAAAATTCAAATGTGATTGTGTCATTACCAGAA
GATAGAACCATCTACGTTTGTCATTTCAACAGACCCATTGATGAGAACTTTGTATAGAAA
TTCTTTGGAATGGCAGGGAAGATAAAGTAAGTGTAGATAGGCGAATATAAAAATAAGGCC
AATAACAAGAGAAAGAGAAGAACTGTCTACTTCGCTATTATCACCTACAAAAACGCATCT
GATTGCTATTAATTGCTCAATTAACCTAAATTACTGCAAAATAAGGTTAATTTATTGACT
AAGAAAGGCGTCAAATTCAGTGAAAACCCCTTTGCTAAGGACCCCAATTTCCTTAATGAC
TAGGAAGAGAGCGATGAAGCCAATGAAGAAGAGGAGGACCACAAAGCCATTATGCAAGAC
GGTGGTTTTACAATGGTCACAGCAGCTGCTCTTAATGAAAACACTCATGGAATCAAGGGC
AAAGGTAGTGATGGAATCAGCACAGTTTTGGGTATCTCCTAAGAAGACGCAGTGGAGATT
TATAAGCAGCAGATGAGAAAAATGAATATGCTGGATGAAGAAGAAGATAACCAAGACCAC
ATAAAGGGAAACGAATCAGATGCATCTGGAGATGGGGATGATTCAGATTCAGGGGATATG
CGTCGTTTGAAGTACACCACAACCTCCAAGAAAAAGAAGGCACTTATGAATGACTTCTAC
AAGTTCCAAGTTAAGGACTACAAAAAACAAAAACTAGAGGAGATTAGAGAGGGATTCGAA
AATGACAAGAGAAGGCTCCAGAAAATGATGCAAAAAGAACAAGAAAAAGATGTTAAAAAT
GCCAAAAAGGAATGA


>Contig19665.0.g106(protein)
MQKPQQQQSNLGKRPQTTQSQLQSQIQKQRQNPNTPTAAISSTSAQVKQNSQVLGSASSE
YKILKIPITKDKIVFYYYRRYTQKSTAETKNSNVIVSLPEDRTIYVCHFNRPIDENFVQK
FFGMAGKIKQVQIGEYKNKANNKRKRRTVYFAIITYKNASDCYQLLNQPKLLQNKVNLLT
KKGVKFSENPFAKDPNFLNDQEESDEANEEEEDHKAIMQDGGFTMVTAAALNENTHGIKG
KGSDGISTVLGISQEDAVEIYKQQMRKMNMLDEEEDNQDHIKGNESDASGDGDDSDSGDM
RRLKYTTTSKKKKALMNDFYKFQVKDYKKQKLEEIREGFENDKRRLQKMMQKEQEKDVKN
AKKE