Identifiers and Description

Gene Model Identifier

Contig12411.0.g65

Standard Name

RRP45

Aliases

Contig12411_0_g65

Description

3' exoribonuclease family, domain 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam01138 ) 3' exoribonuclease family, domain 1
  • ( pfam03725 ) 3' exoribonuclease family, domain 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004631408.99567666834855e-443' exoribonuclease family, dom
ain 1 containin...
SGDYDR280W4.9981275274605926e-36RRP45 SGDID:S000002688, Chr IV
from 1020747-1021664, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12411.0.g65(coding)
ATGTTCAGCAGCTTAAGTATAAACGAGAAAGAGTTCTTGGAGCAAGCAATAAAGTCCAAG
TTCAGAGTGGATGCTCGTGGTCTCTACGATTATCGTCATGTAGATGTCAGATTTGGCAAT
GAAAACGGGCAAGTTTTGTTGAAAATAGGGAAAACTCACATCCTTACTTAAGCTTCATTG
AAACTAGTCAGTCCTCAGCCAGGCAAGCCAAATGAGGGATTTTTCAGATTTAATACTGAA
TTCAGTTCATTATTGCATTCGGCAGAATATACCTCATCTATTAATACTCTGAGTGAGATG
CGTGTTGATATCACTAGATTTATTGATAAAGTACTCAAGTCATCCAGAGCTACTGATAGA
GAATCCTTGTGCATAGTGCAAGGCAGATTAGTATGGTCTTTAAGCGTGGATCTTTTCCTC
TTAAACGAAGATGGAAATGTGATGGATGCCTGTTTCATAGCTAGTGTCTTGTGCCTTATG
AACACAAGACTACCTGAAGTAACTATCTCAAAGGACTAAGTGAAAATAAACTATGAGAAA
GTCAAATATTTGAATGTTCATCATATCCCAATTTGCACTACTTTTTATTTCATTGAGGGT
ATCGATCAACCAATTTTGTATGCTAATGGAAAAGAAGAGAAACTTGCAAAGTCAAGACTT
AGTATGTGCATGAATATATTTGAGGATCTTTGTGGAATGAGCACTTTGGGATGCTTGGAA
ATTGATCCAATTACGATAATTTAATGCAGTAAAATTGCTCTCTAGAAGACTAAAGAACTC
ACTCGCATTATCAGAGAAGCATTTGCAAACAGACATTCATAATAACTTTTGGATTTCATC
TCTGAGAAGAAAAGATCTCAATTGCAATCTCTTGAATTTTAAAATCAAAAAACTGCACAA
TAATTCCTAGAGTCAATGCTGATTGATGAATAGAGTGATGATAAAAAAGCCTAAAAACAC
TCATAGGAAAAATCAAATTCTAAAAAAGGCAAATAGCAACAATAAGTGGCATCAAGCAAA
CAGAAATCTGTTTAATAAATGCAGTAGGATATCAGCGAAGAAGATGAGGATATAGTAGAG
GAGCAGGAAGTAATTAAGATGCTGAAGAGTAACTAAGCAAGTAAAACTTTGTAAAACGCA
ACACTCAAGCAACAATAGTAATCATCATCAATTGCTTCCTCAAAGTCAAAACAGGTAAAA
GTTGATACTGATGAAGACGAGGAAGATGTAAATGAAAGCAGAAGGGAAGATATAAAGAGC
AAGTAGAACAAGAGAACTGATAAACTGAAGGAGAAACAGAACAAGTTGAATGAAATTAAG
AACTTAGATGAAGATAACCTCAGTCTCTCCAGTGCACTTAAGAAGAAAAGCAAGAATAAG
CATTAACAATGA


>Contig12411.0.g65(protein)
MFSSLSINEKEFLEQAIKSKFRVDARGLYDYRHVDVRFGNENGQVLLKIGKTHILTQASL
KLVSPQPGKPNEGFFRFNTEFSSLLHSAEYTSSINTLSEMRVDITRFIDKVLKSSRATDR
ESLCIVQGRLVWSLSVDLFLLNEDGNVMDACFIASVLCLMNTRLPEVTISKDQVKINYEK
VKYLNVHHIPICTTFYFIEGIDQPILYANGKEEKLAKSRLSMCMNIFEDLCGMSTLGCLE
IDPITIIQCSKIALQKTKELTRIIREAFANRHSQQLLDFISEKKRSQLQSLEFQNQKTAQ
QFLESMLIDEQSDDKKAQKHSQEKSNSKKGKQQQQVASSKQKSVQQMQQDISEEDEDIVE
EQEVIKMLKSNQASKTLQNATLKQQQQSSSIASSKSKQVKVDTDEDEEDVNESRREDIKS
KQNKRTDKLKEKQNKLNEIKNLDEDNLSLSSALKKKSKNKHQQ