Identifiers and Description

Gene Model Identifier

Contig18372.0.g87

Standard Name

RRP42

Aliases

Contig18372_0_g87

Description

3' exoribonuclease family, domain 1

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01138 ) 3' exoribonuclease family, domain 1
  • ( pfam10833 ) Protein of unknown function (DUF2572)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007263407.000255027549774e-173' exoribonuclease family, dom
ain 1 containin...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18372.0.g87(coding)
ATGAAGTAATAAATTTGTGAGAACGAGAAAGTATTCATTACTGAAGGGTTTTAGTAAGGG
ATAAGAAGAGACGGCAGAGGACCTCTTGATCACAGATCTTACAAAATTAATTTGGGAACT
ATACCACATGCATTCGGTTCAGCTTCATTAATGTTTGGAGAAGAGGAAGTTTAGATAATT
TGTGCAATTAAAGCAGATTTATAGAAACCATTACCATCAGAGCCAAAGAAAGGGCAAATA
AAGTTTCATTTGGAATCATCATAAACTGGATCATCACTTTTCACAAGAGAAGAGCAATCT
GAAATCATAAAGAACAGATTATTGAACATACTCTATACTCTGTATGGAAATATTATTGAT
AGAGAAGAATTGAATGTATTTGAAGGGTAATTTTCATGGTTATTGAATGTTGATATTTTG
GTCATGGAAGAGCTATCATTCCAGTAACTTGACTATATCGGTTTAGCTATAAGATCAGCA
TTCTTGGATTTTTAACTTCCTGCAGTAAATGCCACTTTGAACAATAACACTGGAAAGATA
GAAGTTGGATTAGTTGAAGAGATTTATGAAGACCAAGATAACACTGATAAATTAGAAAGA
CTAAGGTCAGCAGCAAAAGCTCCTTTTCTATTTTCAGTAGGATTCATTAGACACGAAGTG
TAGGATATTGTAGGATTCGATGCTGATGACTTTGAAATTCAATGCTTTGACTAGATACTT
CACATATCAGTGGATTCTAATTTGAGAATTCATGGAATGGAACAATCAAAGGGAAATTCA
ATTTAACAAGGCTTAATGTTCTCTAAGTGGTTGACTTCAGGCAACTTATCAAAGATATTG
AAGCCAAAGTTAATAGAGTTCGAAAGAATGAGCTCAAAATTAATTAGCTATTGA


>Contig18372.0.g87(protein)
MKQQICENEKVFITEGFQQGIRRDGRGPLDHRSYKINLGTIPHAFGSASLMFGEEEVQII
CAIKADLQKPLPSEPKKGQIKFHLESSQTGSSLFTREEQSEIIKNRLLNILYTLYGNIID
REELNVFEGQFSWLLNVDILVMEELSFQQLDYIGLAIRSAFLDFQLPAVNATLNNNTGKI
EVGLVEEIYEDQDNTDKLERLRSAAKAPFLFSVGFIRHEVQDIVGFDADDFEIQCFDQIL
HISVDSNLRIHGMEQSKGNSIQQGLMFSKWLTSGNLSKILKPKLIEFERMSSKLISY