Identifiers and Description

Gene Model Identifier

Contig20442.0.g90

Standard Name

RRP40

Aliases

Contig20442_0_g90

Description

Tht1-like nuclear fusion protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam04163 ) Tht1-like nuclear fusion protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010505902.000470901975128e-28hypothetical protein
SGDYOL142W2.999534586690157e-23RRP40 SGDID:S000005502, Chr XV
from 55558-56280, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20442.0.g90(coding)
ATGGAACTCAGCAGTAATTAATAGTAAACTGTGATCGCTGCAGGAGATATCTTGAACTTT
GACACATTAGGCTAATCATTCAGATTACAGAGTAAAACTGGAGCCTTCAACCTAAAATTT
GAGAATAATCAAGATACTGGCTCTTAGCAAATAAGATATGTAGCTGCTAAATCTGGTATA
TTAGAGACTAATCAAATCGGTGGAGGGAAATCAAAATAAAAATCTACTGGGTAGACTAGA
CAGAGATTGGAAGTTGATATTATCCCCCTTAATTCTAACAGGTATACACCTCAAGAAAAC
GATGTGGTAATAGGGACAGTAATTTAAAAATCTCCAGAATTTTTCACTATTGATATTAAT
AGTGAGTCTTATGCTTAATTGAGCACTCTTGAATTCTAAAATTCAACAAGAAAAGATAGA
CCTTAATATCCAGAGGGAACCTTAATTTACTGCAGAGTGCTAAGATGTGAAAAGTTCTCA
AAACCGCAATTGAGTTGCATTTCATTGACTCATAAGAAAGCTTGGAATTCAGGAGAGGCA
TATTTCGGAAATTTGACTGAAGGTTTTGTTAAAGATTTCCCAATCGCTTTTTGCAGACAA
CTTCTGGCAAATTCCTCTAGTGAGGGCATTCTTGACAAATTGGGCGAGAGAATCTAATAT
GACATAAACATTGGTTATAATGGCAAAATATGGGTGAAAACTGCAAAAATTCAAGAAACT
ATATTTATTTTCCAAGCCTTAGAGAGAATTCTTGAAAGTGGTCATACCTAAGAAAATATT
CAATTTGTCATGAAAGCTCTCGTTGGGCAATGA


>Contig20442.0.g90(protein)
MELSSNQQQTVIAAGDILNFDTLGQSFRLQSKTGAFNLKFENNQDTGSQQIRYVAAKSGI
LETNQIGGGKSKQKSTGQTRQRLEVDIIPLNSNRYTPQENDVVIGTVIQKSPEFFTIDIN
SESYAQLSTLEFQNSTRKDRPQYPEGTLIYCRVLRCEKFSKPQLSCISLTHKKAWNSGEA
YFGNLTEGFVKDFPIAFCRQLLANSSSEGILDKLGERIQYDINIGYNGKIWVKTAKIQET
IFIFQALERILESGHTQENIQFVMKALVGQ