Identifiers and Description

Gene Model Identifier

Contig16332.0.g85

Standard Name

RRP4

Aliases

Contig16332_0_g85

Description

Exosome complex exonuclease RRP4 N-terminal region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam14382 ) Exosome complex exonuclease RRP4 N-terminal region
  • ( pfam10447 ) Exosome component EXOSC1/CSL4
  • ( pfam13375 ) RnfC Barrel sandwich hybrid domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYHR069C4.997860539111522e-53RRP4 SGDID:S000001111, Chr VII
I from 234658-233579, Gen...
T. thermophilaTTHERM_005865401.999534248571833e-46hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16332.0.g85(coding)
ATGGAACTTGTAGGTGACTAATATGTGACAACTGATGTCAGCATGAGAATTGTGGTACCA
GGTGATTACGTTGATGAGGGCTTTATTGCCGGGCATGGTACTTATGAGCAGGATGGCAAA
ATTTATGCTTCACTCGCAGGAATTGTTCATAGAATAGACAAAGTTATCTGCGTGAGACCC
TTAAAAACTAGTTTCAAGCCAGACATAGGCGATGTGATAATCGGACGTATAGTCTCAGTA
GAGAATAAAAGATGGGCAGTGGACATTAATTCTTACTAACACGCTGTGCTAAACCTCACA
AACATCAACTTGCCTGGTGGACTGCAAAGAAGAAGATCTGAGGAGGATAAGATGCAAATG
AGGTCATTTTTCAAGGAGAATGATATTATCAGTGGGGAGGTTTAAGGCATCAGCACACAC
GATGGCAAGATTAACATGCAAACAAGGAACTTGAAGTATGGAAAACTCATGAATGGGTTC
ATGGTGAAAGTTGATCATAATTACATTCGCCGCATGAAATCACACATTTTGGAGTTTTTT
GCTGAATAATGGCAGCCAATTGGAGTTATAATAGGAACTAATGGGTATGTATGGATTTAC
TTGCCAGACAAACAAGCTTCAAATGAATCTTAAGCTTAGTAATTGAGGACCAACATAACA
AAGGAAATTCGCCTATAAATGTCAATAGTAAGAAACACAATAGTAATATTGGAGAAAATT
TAGCTTCCAATCTTCAAGGACACAATCTAAAAGGTTCTTGATACCCAGAAACTTCTCAAC
GTTGACCCCAAGGACATGCTTAGCAGATATGAAGAACTTGGAGCTGATGCCAAAAACATG
ATTGAATCAGAGATTAACTTAAAGAAGCCCATGGATATTCAATTAATGCAAAATACTATG
ATGGGTGATAACGATTTCATTATGAATTGA


>Contig16332.0.g85(protein)
MELVGDQYVTTDVSMRIVVPGDYVDEGFIAGHGTYEQDGKIYASLAGIVHRIDKVICVRP
LKTSFKPDIGDVIIGRIVSVENKRWAVDINSYQHAVLNLTNINLPGGLQRRRSEEDKMQM
RSFFKENDIISGEVQGISTHDGKINMQTRNLKYGKLMNGFMVKVDHNYIRRMKSHILEFF
AEQWQPIGVIIGTNGYVWIYLPDKQASNESQAQQLRTNITKEIRLQMSIVRNTIVILEKI
QLPIFKDTIQKVLDTQKLLNVDPKDMLSRYEELGADAKNMIESEINLKKPMDIQLMQNTM
MGDNDFIMN