Identifiers and Description

Gene Model Identifier

Contig4857.0.g1

Standard Name

RRP36

Aliases

Contig4857_0_g1

Description

Domain of unknown function (DUF947)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam06102 ) Domain of unknown function (DUF947)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005789400.00000000009998509410508463hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4857.0.g1(coding)
ATGACATTTGAGGAGAGATTGAAACTCAAACAAAAAACTGGTTATGATGTTGTTAAAAAG
GAAGATGTATTAATGAGAAAAGAGAAGGCAGAAAAGTTGACTAATAAAGTGAAATTAGGA
AAGAAAATGCCTAGAGAAAAGTTCTCAAAACTATAAGTATCAGTTTTAAGACCCTTAAAT
ATGCAATCTGTGTAAACTAAGGGTTCAGCCCCAGCTAAGCTTCACACTCATGATCCCAGA
TTCGATGCACGTTCTGGTAATCTAAACGAGGGTCTCTTCAAAGAGTCATATGCTTTTATT
AAGGAAGTTCAAGACGAAAGATTTAAAAAGCTTGGTGAAGCTCTGCGTAAGGCCAAGAAA
GAGGGTGATAAGGATAAGGCCTAGAAGTTGAGAGATATGATTGGTGATGAAAAATCATAC
AAAAATAAGGGCAAGTAGAAGCAATAGGAGAAGGAAGTCATTAAGGAGGCTAAGAAAGCC
AATAGAGAGAGAGTTGAGAAAGGTCTGGAGCCTGTTTATCTCAAGAAGAGAGACATCAAA
GAAATGAAGGTCAAGCAGAAATTCGAAAAGTTAGACAAAGAAGGCAAGCTCGAATAGTTT
ATTATGAAAAAGTAAGAGGAAAAGGATAGACTTAGAAAGTGA


>Contig4857.0.g1(protein)
MTFEERLKLKQKTGYDVVKKEDVLMRKEKAEKLTNKVKLGKKMPREKFSKLQVSVLRPLN
MQSVQTKGSAPAKLHTHDPRFDARSGNLNEGLFKESYAFIKEVQDERFKKLGEALRKAKK
EGDKDKAQKLRDMIGDEKSYKNKGKQKQQEKEVIKEAKKANRERVEKGLEPVYLKKRDIK
EMKVKQKFEKLDKEGKLEQFIMKKQEEKDRLRK