Identifiers and Description

Gene Model Identifier

Contig10402.0.g75

Standard Name

RRP15

Aliases

Contig10402_0_g75

Description

Rrp15p

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002208300.0000004998288985444982hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10402.0.g75(coding)
ATGGAGAAATATACTAAGCAAAATAAGTTTGCAGCTTAAGAGAGAAAACCTTAAATTCCA
GAGAATAAAGGTCCAGGAGTTGTAGAATTCGAAGACTTTAACAAATTAAAGAAGAAAAAT
GTGAGAGGTTTACTCAGGAAGAGAGCGAAGAGATATGAATCTGACAACACTGGCTCTTCT
GATGATGATGAGGTGAGAATACCTAAAAACAAAAAAACAGTGGTCAAGTCTTCATTCGTG
TCCGCTTTCAACTCTATTATCAACAAGAAAATCGAGGATCAGCCAACTAATTCTGGTCCA
TCAGAAGGACCTATTCTCGCTAAGTATAAGAGACCTGCCAAGGAAGTCACAGAGGAAAAG
AAGCGTGATAATGAAGTGAGATAGAAAAAGCAAGAGAAAGAACGCCTAAGAATTATGGGA
AGAAATATACCTACTGTAGAGGATGAACCCAGGGAGAGGGAATTATAGATTTTTGCAACG
AAAGGAGTTGTGCAGCTATTCAACGCAGTTAGAGAGTTCCAAGACAATTAGACAAAAGAA
GCCAAAGACGCCATCAATGAAAGCAAACAAAGAGCAGTAAACATCTTAAACCAAGTGGGT
TCAGATAAAATAAACGCAGGCTAACCTTCCTCAAACTAGAGAATCATTGAATAACTACAG
TCCAGACAATCGAGATGGAAGGTGCTTGAGGATGATTCAGAAGACGAAGAAGGAAATATC
AAGGTAGTAGAGGACTACGATGAAGATGACAATGCAGAAGAGGACGATCAAGAGTGA


>Contig10402.0.g75(protein)
MEKYTKQNKFAAQERKPQIPENKGPGVVEFEDFNKLKKKNVRGLLRKRAKRYESDNTGSS
DDDEVRIPKNKKTVVKSSFVSAFNSIINKKIEDQPTNSGPSEGPILAKYKRPAKEVTEEK
KRDNEVRQKKQEKERLRIMGRNIPTVEDEPRERELQIFATKGVVQLFNAVREFQDNQTKE
AKDAINESKQRAVNILNQVGSDKINAGQPSSNQRIIEQLQSRQSRWKVLEDDSEDEEGNI
KVVEDYDEDDNAEEDDQE