Identifiers and Description

Gene Model Identifier

Contig22160.0.g70

Standard Name

RRP1

Aliases

Contig22160_0_g70

Description

Nucleolar protein,Nop52

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000836800.0000000000010000211161514907Nucleolar protein,Nop52 contai
ning protein
SGDYDR087C0.000000000040005666873964816RRP1 SGDID:S000002494, Chr IV
from 618306-617470, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22160.0.g70(coding)
ATGAGTTCAGCACTAATCGACAAGAGATAATTAAAACAAATAAATTCTTAGCTGGCAGCC
TCTGCCCAGTAAGATGTCAGAGATAAAGCTTTGAAAGATCTAACAAAATTATTTATTCAA
GAAAAGTCATGGGTTAACGATCATATAAAGGATTTAAGAGCTATATGGGAAGGTCTCTTC
TACATGTTCTGGCACTCAGACAAGGCCCTATATTAGAAGGAAGTATCAGAGAAAATAACT
CATATTTTCGCTTAATTAGGAGATTTAGAGCAGCTAAGTACCGTGATTACCCTGAAATAA
AAACAGTGGTTTGAGGCATTTATGTATATTGTCAATTTGCACTGGGACAAAGTTGATAAT
TACCGCATTGACAAATATCTTATGTTCTTAAGACATTAAATCTATGAAGTTCTAGTGGCT
TTGAGAAAGAAAGATTACCCAGAAGAGGATATGGAATGGTTCAAGAAAATCATCCAAAGT
CTTTATATGGAGGATGAACTAGTCAGCAAGGGTATTCCACTCCAAATTTGTGATATTTTC
TTGCAAGAACTCAATCGTTCAGACTCCCTAAATTTATCCCTCCAAAACTTGTCTAGCATT
CTAGAACCTTTCCTTTATGCTATGGCACACTGCAAAAATAGGATTTTAGTGAATCGTGTT
ATTGAAAAAGTTATGGAACCCCTTCTTGAAAATAACGTTACAGTTCATGAAGATTCTAAC
TCTAGTGAAGAGGAGGAAGTTTACAGCTATGATCTCTCAAGAGGCAAATACATGGACGGT
GGTAGAATGCATCCAAATATTTAGAAAGAAGTTTAAAAGTTGATTGACTAGAGATTCACT
TTCCCTAACTTCAACATCTTGCTCTATGCTCAGGATTAAATTTTCAAGTACGCCTCTGAT
TCAAAGACCAGAGAAGAAAATCGTGATATTCTCTATCAGCTGTATGACAGAGCTTTGAAA
CTCGAACCAGAACCCGAAGAAAAGGAGCTAACTTTTTCACAAAGAATGCTTATCAATAGA
GCCAGAGCTTTTATTACTAAGAAAATGGAGAGACGTATGAGAGTTCATTAGCAAAAGAGA
GAAAGAAAGATGATCTACAAACTTGGCAATATGATTTAGAACCAAATGCTCAGCCAGAGT
GAAATGGATGAAATGAAGGAAGAGGCTTTCGACTTGAAGCATGATAATTCAGATGCTGCT
TTACACGGATTCGATGAAAAGCAAAAGCTCTTGGAGTTATTGACTTAACAAATCAATTCT
CAGAAAACTGGAGGGGATGTGAATGGCATGCAGAAAATCTACCTGTAACCAGTCAGTCAT
AACGGACAGCCCATTAAGAATGGCGTCAAGTAACAAGTTCTGGTTACACTACCCGCAGCT
CAATAGAAATAGTATATGCAAATTCAATAATCTTCCAATGGAAATAAGGAGAGCAGTTCA
AATGGAAAGCATGAGTAAAAGTAATAATAAGCAGTGAGCAATGGAAAAAGCCAAAATGGT
GTTAAGAAACATCAAGTCAGCATTGCTAGTAAAGATGATGAGGATGAAGTAATCAAGATC
AGTGGCTAAAGCAAAAAACTAAATAAAAATAAAAACAAGAAAAGGAAGCACAGAGAAGAA
GTTTCTAATGGCAATGGACACTCAAATGGAGAACTTAAGAAGCGTGTGAAGTTTGATCTC
CAACAAAACCAATCAAGAGAGTTCTTCACTTACGGGAAAGTTGCCACACAGAGTCACCCT
GACAGCAGAATGAGATCACCCAGCAAGGGCGCCATCAAAGCTAAATCCATAAAACAACAT
CAGAAAATGATGAGCTCATTCTAGTGA


>Contig22160.0.g70(protein)
MSSALIDKRQLKQINSQLAASAQQDVRDKALKDLTKLFIQEKSWVNDHIKDLRAIWEGLF
YMFWHSDKALYQKEVSEKITHIFAQLGDLEQLSTVITLKQKQWFEAFMYIVNLHWDKVDN
YRIDKYLMFLRHQIYEVLVALRKKDYPEEDMEWFKKIIQSLYMEDELVSKGIPLQICDIF
LQELNRSDSLNLSLQNLSSILEPFLYAMAHCKNRILVNRVIEKVMEPLLENNVTVHEDSN
SSEEEEVYSYDLSRGKYMDGGRMHPNIQKEVQKLIDQRFTFPNFNILLYAQDQIFKYASD
SKTREENRDILYQLYDRALKLEPEPEEKELTFSQRMLINRARAFITKKMERRMRVHQQKR
ERKMIYKLGNMIQNQMLSQSEMDEMKEEAFDLKHDNSDAALHGFDEKQKLLELLTQQINS
QKTGGDVNGMQKIYLQPVSHNGQPIKNGVKQQVLVTLPAAQQKQYMQIQQSSNGNKESSS
NGKHEQKQQQAVSNGKSQNGVKKHQVSIASKDDEDEVIKISGQSKKLNKNKNKKRKHREE
VSNGNGHSNGELKKRVKFDLQQNQSREFFTYGKVATQSHPDSRMRSPSKGAIKAKSIKQH
QKMMSSFQ