Identifiers and Description

Gene Model Identifier

Contig11260.0.g15

Standard Name

RRMX9

Aliases

Contig11260_0_g15

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14446 ) Prokaryotic RING finger family 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004448300.0000000000019997478866288316hypothetical protein
SGDYER068W0.0000000020002373268528243MOT2 SGDID:S000000870, Chr V f
rom 293050-294813, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11260.0.g15(coding)
ATGATCAACCACTCAATCCCTTTTGAGTGTAATTTTTCTTAAGTATGTAATGACTGTGAG
CTTGAGTTTCCAACTAAAAATCATCTGGTCACATGCAAGTGTTCTAACATAAAGTGGTGC
TTAGACTGTGCTAAAAATCACTTTGATGACCAGATTTCATCATCATCTACCAACCAAAAC
TCAATGAATCAATCGTATGATCAATACAGATGTGAAAGATGCAACAAGGTTGTTTAGCTT
CAAGCTTTTAGTGATTAACTCTCCTCTATTTCTTCACTCAGTTCAATTCATTGTTATGGA
TCACAAACCTCAAAGAAAACATAACTCAAGCCTCGTAAGATTGAACCACTAAGACCAAGA
GACACACAACTTGTTGAGTCACTTCTCAAGTTCAGAATCGTTCAAGAAAATTTGCTATAT
GTGATTGGAATCCCTGAGAAATATGCTGATGAAAATCTTTTAGCCTCACAAAGATATTTT
GGACTATACGGTGAAGTAAAGAAAATCAGAATCAATCGCTGCCCTAAGGACTCCTACGAA
GGTTAGTGTGCCATATATGTATGGTATTCTCATCCAATACAAGTAGCCGTCGCTATCAAG
TGCCTTTCAGGACTCAAGTTTGGAACAAAAGGTGCTCTGAAATGTTCATACGGAACATCA
AAGTATTGTGCTAATTTTCTCAAAGACTCTACTGTGAAGCCTTTGAAAGTGAAAAGTCCT
GTCCTTGAATCTTTCATGTATTTGCTTGGAATCTAAATTCCATAAAGTGAAATGCAAAGA
TATTAAGACTATCTCTAAAAACCCTCGGATCTTGGATTCCCAAATCCATTTGACTTACTT
GGCAACAGAGTAGAACCTGCAATCACTATGAGAATAGATTAATACCTCTTTAAGGAGTTC
AACAGAGTCTAGTATCTCTTTGTCAAAGACAATGACAACTCTTTGATGGTCACAAAATTC
TACTATCTCCCAGAGCAGTAATAGTATGATTACTACTCTGACAATAATGAAAGATTTTCC
GAAATAATGCTTCCATCGATTGAACCAGTCTTTGAAGTGATTGAAAAGTCTACATCAAAG
AGCGATCAAGGTAGATGTATTCAACCATTCAATCTCTAAGATTAATAGAAATCACTCCAA
AGCAATGAACTCAACAAAGAAAATCTTCTAAAGCTGTAGCAGTCCATCAATTTTAATGGA
ATTTAGAAGTCAGGTTAAAAAAAAAGAACTATCAAGACCCATCACAGCCCTAGGATTTTT
GAATACATTGCTGAGTAAAACTATCCCCGGCACTTGAAGCCACAAATTCAACAATATTCT
ATGAATGAGCGCCTTGGTTAAATGAGTTAACTTTAAAACAGCTACTTAGTTTGTACAATG
CTAGCAAATGGTTAATAAAACTTCTAATCAAGCTGTAGATATGAGTAGTAGTTTTAAGGG
CAGTCTTAGAGTTAACCAAGCTTTGCACCTTTGAGATATCCATTCAATCAGATTCAAGTC
CAACCTAGTTTTGATCATTAAGTGAACTAGCAAGTTTACATCTTTTAGTAGTAACTATAG
GCAAATCAAAGATCAACTCATGCAGCTTAGGAACCTTTTCAATACACAAGCCAAAGGTCA
ACTCAAGTATCCTAGGAACCTTCTCAACATTCTTTAAGTCAGTCTAGTATGTATAGTTAA
GCTTCAAACATTGAAAAATCTTCAGATTTAAGATCAATCGATGTCCAAACATAGAACACT
AACTGGTTAAGTTCAAAGGAGTTTGTTCCTAAGAAACTAGCAAAGCAAGCTTCAGTCATA
AGCTCTGTGACTTCATAAAGTGCTGATTCATGTTTAACTACTCCCTAACTTAAAGTCTAG
AGCAAAATCAAAGAGTATTTTGAGTCAACTGTTGTTAACCCTGAAAGCGATCAAGAATCA
TCATATCCAGCAAGTAGAAAAGATTCAGAGATCACTATACTCGATGTTTCTGAAGTCCAT
GAAAAGAGCTTTGTTTTCATTCCTCAAACCTCTAGGATACAATATAAAGTGTTTTAGAAT
GAATAGCAAGGTAATTCAGAATAAGAGATTCTTGAAAGAATGACTGAGTCTATTTGCCAT
TTTGTGGTAAACAATGTATTGAAAGATGATGAAATTGAAAACAGTCAATCATAAAGAATG
TCTAATACCTCAATAAAGTAGCAAACCATAGGATCTATGTGCGATGAGATGTTGGTTAAA
GCTTTGAAGAGAGATCAGACAGAGAAATCTTCTCAAATCATAATGAATGATTTGCTACCT
TCATTTATGTATCAAGGTTCTTCTTAACTAGAGCTGATGATGAAACAAATTCAACAGCAG
ACCGAGGATAAACTGAAAGAAGATTTTTCTTCTCTTCATGCCAAGTAAGTTCCTTAACAT
ACAGAGTCAGATGATTTGGAGTGTGATTCTATATTCCAGTTCAAAGATGGAGTCTTTCCA
TCCTTCCAGTTTTGTAATAATATCACAGCTATTTGA


>Contig11260.0.g15(protein)
MINHSIPFECNFSQVCNDCELEFPTKNHLVTCKCSNIKWCLDCAKNHFDDQISSSSTNQN
SMNQSYDQYRCERCNKVVQLQAFSDQLSSISSLSSIHCYGSQTSKKTQLKPRKIEPLRPR
DTQLVESLLKFRIVQENLLYVIGIPEKYADENLLASQRYFGLYGEVKKIRINRCPKDSYE
GQCAIYVWYSHPIQVAVAIKCLSGLKFGTKGALKCSYGTSKYCANFLKDSTVKPLKVKSP
VLESFMYLLGIQIPQSEMQRYQDYLQKPSDLGFPNPFDLLGNRVEPAITMRIDQYLFKEF
NRVQYLFVKDNDNSLMVTKFYYLPEQQQYDYYSDNNERFSEIMLPSIEPVFEVIEKSTSK
SDQGRCIQPFNLQDQQKSLQSNELNKENLLKLQQSINFNGIQKSGQKKRTIKTHHSPRIF
EYIAEQNYPRHLKPQIQQYSMNERLGQMSQLQNSYLVCTMLANGQQNFQSSCRYEQQFQG
QSQSQPSFAPLRYPFNQIQVQPSFDHQVNQQVYIFQQQLQANQRSTHAAQEPFQYTSQRS
TQVSQEPSQHSLSQSSMYSQASNIEKSSDLRSIDVQTQNTNWLSSKEFVPKKLAKQASVI
SSVTSQSADSCLTTPQLKVQSKIKEYFESTVVNPESDQESSYPASRKDSEITILDVSEVH
EKSFVFIPQTSRIQYKVFQNEQQGNSEQEILERMTESICHFVVNNVLKDDEIENSQSQRM
SNTSIKQQTIGSMCDEMLVKALKRDQTEKSSQIIMNDLLPSFMYQGSSQLELMMKQIQQQ
TEDKLKEDFSSLHAKQVPQHTESDDLECDSIFQFKDGVFPSFQFCNNITAI