Identifiers and Description

Gene Model Identifier

Contig612.1.g101

Standard Name

RRMX5

Aliases

Contig612_1_g101

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006377800.00010003404299092957hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig612.1.g101(coding)
ATGAATAATAATTCAGCATTGACAAATGCAAATTTCCCCACGCAGAATAGTGCCCTTGAC
ATAACTGTAGATCATGCAAGCAATCAAAGCATTATTTAACACACTAAATAATCAACCATT
CCCAATAACAGTTATATGCGTTACTCAAAGCAATAAAAGTAATAAATAGACTTATCAACT
TTAAATGAGGAGATTGAAAAAGTAGCAGGTAAACATGACAACTCAGTTTTATCAACTCAA
CATAAACTTATGCCTACTCAATAGTATAATCTAAACGAGGATCTATCGCCCTCTTAATAG
AAGTAGTATGTGAGAGGTACACCCTAAGATGGTTTACTTAATTTCAAGAAGAAGTTTGGA
GTAACGGACACTAACTAGTAACCTTTAAGGAATATGACTACAAATGTTGATGCTTACAAC
TGGCACTAGAATAACTAAATGTGGAAGTATCTTTATTACTACTCTCATTTCGGATAAACT
ATTGCTATAATATTATTCCTTATGATTTTCAGAGTCTACTTGAACAGAAAATCAAAACAG
GTTCTAAGAGTTGCTTCAAACAATTACAAATACTGTGTTTAAGTTGATTTTACAAAATAC
AATGAGAAATATTATTACATAGACGAAACTGACATAAAAAATAAGTTCAAGCAGTTTGGA
TCTATACAATAAGTTTCAATAATAAGAGACTATGGAAGACTTCTCTATGCTTTTAAGGAA
GTTGGTAACTATCAGAAACTTATTTAAATGACTTAGTATAAAAACCGTTATGGAAATGGA
AAATTGTACGGAGACATTAAGAAGATGGAGTTACAGTTACAAAACTTGACTCATGAAGCA
AATAAGTTAAACACATAAAAGTATTGTCATGAGCAATTCCCAATAGCCACAGCAATCATT
AGATTTTAATATATTAATGAAAGAACCAATTGCATTGAGTAGTTTAACAAGAATAAGAAT
CAAGTGAATACTGATTACGATATGGACCCTACTGTGGGAAAGAATCAATTTAAAATAGGC
AAGCCATTAGATGCATCTGTGTTTAACTACGATTAGTACTATAACTCTACTCATAGATCA
GTCGGTTTATCTTTTCTACTAGGATCCTTCATTCTAATTATACTTGCTTCTACTTACCTG
ATATGTTTCACTTTCAGAGAATATCTGAAGGAAATAGAATATAAACCTATATGCAAAGAC
GTTTCATACCTAGGCAAATAAGAATCAGACTATTTGAGTTAGATCGACAAAGATTAAGTG
AAAGAATGCTTTTGCTCATAGTATTCCTCTTTTGATATAATCTACGGTAAATACACCAAG
TACTATGACTACTGCTATGCTTATGCTAAAAACGTTAAATATTACTACTCAGCTATGTTT
TTCTTGGCATTTGGCATTTACTCCCTAAATATGCTTATTGATTTGATAGTCACACAATCT
AGTAAAATGCTAAGATTTAAAGTGGCAACTGACAAAGCCAAGTATGTCATGAGTGCTATC
TTTTTATTTCAGTTCCTAAATACTTGGCTTCCTCTTGTATTGATCACAATGAACGATACC
GATGATAGTAATGTGTAAACTATCTCTAAGAATTTAGACTTTGATTTGCCAAATGGTAGA
AACTTTAACACTCTAGTTATGTTTGGATCTTACAGGTCATCCACTAGGGAATGGATATAA
TGGATCAATTTCCCAATTTGCACAATAATAGTGCTTCAACTCATTTTTCAGATGATGCAC
TTTGGTTTATCTATTTTAACTCACAAATTAATTCTAAAGTACAAACAAAGAGACCTGATT
TTGAAATCAGAGTTCCACTAAGTTAATAAGGGAATCAAGTTTAGAATTGAAAACTATTTG
GCATTCCAAGCTGCATACATTTGTACTGCTTTACTATTTAGTGCTGCAATTCCTGGCGTG
ATGATGGTGATCCCTCTATATCTAACATGCATTTTTTAGATAAGGAAATCTATAATGTTA
ACACATTATCGTGTGCCTCTTCGTTACGACGTTTCACTTCTCCAGAGATTTGTAACTCTA
ATTCTTATGGGCATGAGCGTTTCACTTGGCTTGACTTTATGGGTATTTTCTGAGCCCTTG
ATTTTCCCAATAAAAGTTAAAATTTTCAACATTAATGCCACTAATTTCTTCTATGTGGAT
GACATTTCTCTGTATGACAGGATCTTTACAAGAAATGGTTTTTAGTACTTTGTGATACTT
AACGTGCTGATGACTATACTTCCTATGAGTAAATACATCAATATTGCAATCAATGAAGGC
TTCAAATTATTCAATAAAAAGAACAATAAAGTGCAGTCATTGGATGGGAGTATTAACAAT
GACACAGTCAAAGTCAATGATTTAGAAAAAAGAACCACTGATGAGACTTAAGAACTTAAT
CACTTGACTAATTACGTCAATCTTATCAGCTATAATGCTATTGACCATAAGAAATACAGA
AGAGCTATTGTGCTTCTAAACAAAAGTTCATCTGAAAAGTAAAATGACGGTTATACTTAA
TAAAATAATGATGAAACGGTGACTAAATTTTGA


>Contig612.1.g101(protein)
MNNNSALTNANFPTQNSALDITVDHASNQSIIQHTKQSTIPNNSYMRYSKQQKQQIDLST
LNEEIEKVAGKHDNSVLSTQHKLMPTQQYNLNEDLSPSQQKQYVRGTPQDGLLNFKKKFG
VTDTNQQPLRNMTTNVDAYNWHQNNQMWKYLYYYSHFGQTIAIILFLMIFRVYLNRKSKQ
VLRVASNNYKYCVQVDFTKYNEKYYYIDETDIKNKFKQFGSIQQVSIIRDYGRLLYAFKE
VGNYQKLIQMTQYKNRYGNGKLYGDIKKMELQLQNLTHEANKLNTQKYCHEQFPIATAII
RFQYINERTNCIEQFNKNKNQVNTDYDMDPTVGKNQFKIGKPLDASVFNYDQYYNSTHRS
VGLSFLLGSFILIILASTYLICFTFREYLKEIEYKPICKDVSYLGKQESDYLSQIDKDQV
KECFCSQYSSFDIIYGKYTKYYDYCYAYAKNVKYYYSAMFFLAFGIYSLNMLIDLIVTQS
SKMLRFKVATDKAKYVMSAIFLFQFLNTWLPLVLITMNDTDDSNVQTISKNLDFDLPNGR
NFNTLVMFGSYRSSTREWIQWINFPICTIIVLQLIFQMMHFGLSILTHKLILKYKQRDLI
LKSEFHQVNKGIKFRIENYLAFQAAYICTALLFSAAIPGVMMVIPLYLTCIFQIRKSIML
THYRVPLRYDVSLLQRFVTLILMGMSVSLGLTLWVFSEPLIFPIKVKIFNINATNFFYVD
DISLYDRIFTRNGFQYFVILNVLMTILPMSKYINIAINEGFKLFNKKNNKVQSLDGSINN
DTVKVNDLEKRTTDETQELNHLTNYVNLISYNAIDHKKYRRAIVLLNKSSSEKQNDGYTQ
QNNDETVTKF