Identifiers and Description

Gene Model Identifier

Contig13840.0.g93

Standard Name

RRMX4

Aliases

Contig13840_0_g93

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11608 ) Limkain b1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008425004.999723464643358e-28U1 small nuclear ribonucleopro
tein A
SGDYIR009W0.00000000000040012475857291343MSL1 SGDID:S000001448, Chr IX
from 374525-374860, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13840.0.g93(coding)
ATGCCCCAATCGCAGTAGTAGCAGCACGTGAGCACTCATGCCAGTCTCACGCAGAGACCT
ATTCCTGGCATGCCTCTACCCAATTAGCAATTCATGATGCAACCACCACCATAGTAGCAT
AGTGTATAACAATCATAATCAGGTATTAATCATACTGGATAAATGATGAACAATTTGTAG
ATGCAAAATTAAACGCAATAGTAGTAGAATTTCACTCAACATGCCATAAACTAAGAAGTA
AACATAAAATCAATGCATCTTATCTTAAATTAGTAGTAAATAAAGCAATAGTAATAGATG
GTGAATGTAGTGCCCACACTCTATGTGAGAAATCTCAATGATAAAATCAAAACAGATGAA
ATGAAGATAACGCTGTTCCACTTGTTCTCACAGGTGGGTGAAGTGATTGAAATAAACATG
AGAAATACAAATAATTCACAAAAACTCAGAGGTCAGGCTTTCATAGTATTTAGAGAGCAA
GATATGGCCGATCGTGGGCTTCAAGAACTCAAGGGTTTCAACTTATTCGGAAAGAGTATT
GATATTCAATATGCAAAGTAAAATAGCGATGTTACATTGAAGAACAAGGGAGTTTTCGAT
GACAGCATTCGATTAAACCGCAGACAAAAAAGAAAACAAAAAGATGAACTAAAAAGGAAA
GAAAAGAAGGAGAAGCTTGTAATTGCAGAACAACAATTGAAGCAGCAGCTCAATTACAAA
GAAATGGCGCTTAAATAGTCAAATGCAATTGCAATTGATAATCTTCCGGGAAATTACAAC
TAGTTATTGCTTCAGGAATTATTGAGAAACTATCCAGGAGTTGCAGACTACAACCTAGAC
GTTGAAAAGCACGTTGCTACCGTACACTTCCACACATCTAATGATGCCAAAGTTGCACTT
GCAGGTTTAAATTAATATCAAATTGACAGCGAAGGCACCCAATTAAGAGTGACATTTGTA
ACAAACTGA


>Contig13840.0.g93(protein)
MPQSQQQQHVSTHASLTQRPIPGMPLPNQQFMMQPPPQQHSVQQSQSGINHTGQMMNNLQ
MQNQTQQQQNFTQHAINQEVNIKSMHLILNQQQIKQQQQMVNVVPTLYVRNLNDKIKTDE
MKITLFHLFSQVGEVIEINMRNTNNSQKLRGQAFIVFREQDMADRGLQELKGFNLFGKSI
DIQYAKQNSDVTLKNKGVFDDSIRLNRRQKRKQKDELKRKEKKEKLVIAEQQLKQQLNYK
EMALKQSNAIAIDNLPGNYNQLLLQELLRNYPGVADYNLDVEKHVATVHFHTSNDAKVAL
AGLNQYQIDSEGTQLRVTFVTN