Identifiers and Description

Gene Model Identifier

Contig12586.0.1.g91

Standard Name

RRMX24

Aliases

Contig12586_0_1_g91

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010924709.003524732464762e-66Cytochrome b5-like Heme/Steroi
d binding domai...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12586.0.1.g91(coding)
ATGACTGCTGGACCCATTATTAAAGCAGCTGGCACTGATATTACTCATTGGTTTGATCCC
ATTACAAGAGAGCCAAAAACATGGGTGGATTAAAAAACAAACATGACCTGGTATTATTGC
CCTCAAGGGAGATATCTGCACATCCCCCCTATAGAACCAGACAGCCAATGGGACACCACT
GCTTTCACTCTCCCCTGGTGGAAAGACAAGACACTTTGCATTGGAAGAAACTCCGTGAAG
ACCCGCAAACTTAGAATTATAAATATGTTGACTAAAAACGATGATATTTTGGAGGTCTGC
AGCGAGGAGACCCTCAATGAAATACTCGACAGGTACATGGAACTTAACGAGCACTCAGCA
TCATACACATGGAAAAGACTAGGGAGGCCACTTGACATGCAAAAAACTCTGGAGGAAAAC
GATATCCCCGATGAAACAGAAGAATTCATAGATCTTAACATCGATGAAGACGCTTATATT
CCAGCTGTGCACCTGTACTATAATGATGATCTCACTGTTGCATGA


>Contig12586.0.1.g91(protein)
MTAGPIIKAAGTDITHWFDPITREPKTWVDQKTNMTWYYCPQGRYLHIPPIEPDSQWDTT
AFTLPWWKDKTLCIGRNSVKTRKLRIINMLTKNDDILEVCSEETLNEILDRYMELNEHSA
SYTWKRLGRPLDMQKTLEENDIPDETEEFIDLNIDEDAYIPAVHLYYNDDLTVA