Identifiers and Description

Gene Model Identifier

Contig6954.0.g24

Standard Name

RRMX23

Aliases

Contig6954_0_g24

Description

Putative RRM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6954.0.g24(coding)
ATGAAGTCAGCAGTCAACTCTCAGAATTATCTTACTAGATTAACAAATAATATGAAGCAA
ACTTCAAGTACAAATACAAGGCAAACTGTAGTTCACAGTTCCAATACATCAATCTTCACA
GCGGCGAGGAATAGCGACTGTATTTCTTAAAAGATCAATGATAATGATCAATAAAATGAT
AAAATATTTCAGGATCAAGGGATTACAGATGGTTAAGGGTAGATAAATGATGTGTTTAAT
GAATTATATCATACTACAGACAATAGGAATACCAAAACAACTAAACCTCAACCTATAAGA
GGAAGTGTGAAAATCCCCAATGATAAGACAAAGAGAACTACTCTCTACACCTCTCCTTTG
ACCACAAAGCAATAAACTTAACAGCATCTTCGTACAGCATAAATCTCAAAAAAGAATTCT
ACCGACCTCAATGACCCACCTCAAATTGAAGAAAAAAATAATCAATATTCTTAATAGGGC
TCTCCAACAATTTCAACTGATTAGAAACTTGAGGCTAAGAATGAATCAAAAACAAGCAAC
AATTATTCTACCACTCTTTCAAAGATATAGTAATTAACCCAAAGATGCATTAAGTCATTG
ACACTTTCATGA


>Contig6954.0.g24(protein)
MKSAVNSQNYLTRLTNNMKQTSSTNTRQTVVHSSNTSIFTAARNSDCISQKINDNDQQND
KIFQDQGITDGQGQINDVFNELYHTTDNRNTKTTKPQPIRGSVKIPNDKTKRTTLYTSPL
TTKQQTQQHLRTAQISKKNSTDLNDPPQIEEKNNQYSQQGSPTISTDQKLEAKNESKTSN
NYSTTLSKIQQLTQRCIKSLTLS