Identifiers and Description

Gene Model Identifier

Contig2008.0.g58

Standard Name

RRMX22

Aliases

Contig2008_0_g58

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam11767 ) Histone lysine methyltransferase SET associated
  • ( pfam12913 ) SH3 domain of the SH3b1 type
  • ( pfam06599 ) Protein of unknown function (DUF1139)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003187302.9990241513684e-21hypothetical protein
SGDYOR319W0.00006000996057121373HSH49 SGDID:S000005846, Chr XV
from 912822-913463, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2008.0.g58(coding)
ATGGGATACAACATAAATTAAAATTTTTAAAGTTTTCATAATTAAGGGCAAATACAGTAC
AATCCAAATCAATAGCACTATCAAAACTATAGCAATTCAAGTTATGCTTCCAAAGATCTT
TCAGCTGAAGAATTGTTAAAATAATACCAAAATGAACTTGAGCTTCAAGCTAAAAAAGAA
GCTTCAGGAGAAATACCAATTGGCCCAAAACATGAAAGACAGCTTTATGTTGGAAATTTG
CCACCTACTATCACACATTAGAAGCTAGTTGAGTTGTTAAATATTGCTGTGTGTGTAATG
AAACTCAATGTGAAACCAGGATAGCCAATTCTATCTGCTTGGATCAGCCAAGATGGCCAC
TATGCTTTTGTTGAGTTTAGGACTATTGAAGAATGTATGAATGGTCATTAATTGAACTAA
ATAGCTATTTAAGGACATCCTTTGAAAGTTGGTAAAACAAGGATTCAAAACCAAATTAAC
TCTTAAAATCCTCACAATTTTCCATGCCAAAATTCCGCTAATCAGTAAGTTCTAATGTTA
AGCTAAGCTCTCAGCAATTCAATAGAGATATCAAACATACCCAAATTTTATGAAAACGAC
ACAGAGGCTTTAGTAAAGCTCTTGAAAATGTTTGGAGTGTATAGATAATATTAAATGAAA
GCCCTGTAAAACTAAATTATTTGCTATTGTGAATATGAAAGCGATGAACAGACTAAGAAG
GCTTTGAATGGCTTTAATGACTTACTAGTAAAAGAAAGCAAATTATAAGTTCGAAGATTG
CCTAACGGTCATGCAAGCTAGATTTTTGGATCAACGACTGCCAAATCTATTGACTGCATT
CAAGGAAATTAAAAATCTTCTGATGAACCTAGAAGTAGTAGAGTAGTGGTCTTAAACAAT
TTACTTGTGTTGGAAAACATGAAAACCAAGCAAGAATTTTATGAAGTTGAAGATGATATA
AGAGAAGAATGCGAAAAGTATGGAAAAATCAGACAAGTTATGATACCAAAGCCAAGTCAT
TTAAGTCATAGATAAAAGCTACCCTTTTGTATTTAGATTTAGAGATATGGATCATACTTA
GTAAATGAGGGAGCTGGGAAAATTTATATAAAGTTTGATAAAAGTGAGCAAGCCAAAAAA
TGTGTCGAATAGATGAATAAAAGATTGTATAATTAAAGGGAAGTCATAGCTTCATTATAT
AGTGAAGATAAATGGTATGACAGAATACTTGAATGA


>Contig2008.0.g58(protein)
MGYNINQNFQSFHNQGQIQYNPNQQHYQNYSNSSYASKDLSAEELLKQYQNELELQAKKE
ASGEIPIGPKHERQLYVGNLPPTITHQKLVELLNIAVCVMKLNVKPGQPILSAWISQDGH
YAFVEFRTIEECMNGHQLNQIAIQGHPLKVGKTRIQNQINSQNPHNFPCQNSANQQVLML
SQALSNSIEISNIPKFYENDTEALVKLLKMFGVYRQYQMKALQNQIICYCEYESDEQTKK
ALNGFNDLLVKESKLQVRRLPNGHASQIFGSTTAKSIDCIQGNQKSSDEPRSSRVVVLNN
LLVLENMKTKQEFYEVEDDIREECEKYGKIRQVMIPKPSHLSHRQKLPFCIQIQRYGSYL
VNEGAGKIYIKFDKSEQAKKCVEQMNKRLYNQREVIASLYSEDKWYDRILE