Identifiers and Description

Gene Model Identifier

Contig19568.0.g85

Standard Name

RRMX20

Aliases

Contig19568_0_g85

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam10243 ) Microtubule-binding protein MIP-T3
  • ( pfam08192 ) Peptidase family S64
  • ( pfam09969 ) Uncharacterized conserved protein (DUF2203)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001011500.00000030014504373857585splicing factor, CC1-like fami
ly protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19568.0.g85(coding)
ATGGAATCGAATTTGACAGAACCTTCAAAGACCAATAACATACCCTCCTCTTCAATTAGC
TCCAGGGACTAGAAACCAGCTGGAGAGAAGAGTGTTAACAAAAGCAGAAAAAGAAGTGAT
AGTCGACGAAGAAGCAAGGAAAGAGATAGAAGAGATAGAGATCCTAAGAGAGGCAGCAGC
CGAGATAGAGACAGGGATCACAGACATCGCAGAAGCAACAGAAGTAGAAGTAATGAAAGG
AGAAGGAAGAGAACACACTCCAGAAGTAAGGATAGAAAAAAACATCATTCATCTAGAAAA
CAATCAAGTTCTCATAGACATAGAAGTAGAAGGAGCAGAGATAGAAAGAGAAGAGATAGA
TCCAGATCTCCGAAATCAAGCTCTTCAGATAGCAGCTCATCATCATCCTCTGACGGTTCT
GCCTCAAGACGTAGGCAAAGAGAAGCTGTTAAAAAGAGAACAAGAATATAAGAGAATGTT
CATCCATATTTCTAGAGAAGAAAGGGATAGGAAGAAGAACCTGAGCAATAAAACGGAGCA
CTTTTCTGGGATGGTTTCCAGTGGGTAACAAGAGCTCAATAAGTTTTTGATGTTGCTTAA
AATGCTGTAGATAAGGCCACAAAAACAGTCACAGGAGAGGACAAACAACAAAACCTAGAG
AGAGTTGCTGCTTCTAGAACTGTTATTATTGAAAATATAGCACTAGATTTAGGGTTGACA
GCCAAGGACATCCAAAAGTTCCTGCTGGATCACTTAACATAAATATAGGAAAAGGATGTA
GAAATCATAGATGTAGATATGGAATACGGACCTACTTCTATTGCTGTTGAATTGAAGGAG
AAATGGATGGTTGATAAGATGAAGGAGCTGGATGGTATTTAATGTCTTGGAGAGAAGTTG
AAAGTTAGAAGATTGAATGAAGAAACTGCTTAAACAAATGCCATAGCAGCTGCTATCACT
GTTGCTGCCCTTAAGTCTCTGACATCTACTGGTACTGGGTAGGATGGTGAAGCTGAACTT
AACTTGAGAGCAGGCTCTTTGAAAACAGTTAACCCTTCCTCCGTCATTAAAATATCTAAC
ATTTTGAATAGAGAAGAAGAGTTAACTCCTGAAATCTATGAGGAACTCTACGAAGATATG
GAAGAGGAGTTCAAGAAAGGCCATCATCTCAAGAAAATCAAAATCATCAGAAATGGTGAG
GATAAACTTGGAGCAGAAGTAGGTTCCATATTTGTTGAGTTTATGGATAAGCAAAGTGCC
ACTCAAGCCATTAAACGTATCAAAGGAAGAATTTATGATGGTAGAGAAGTTAGAGTGTAA
TATGTTGATGAGAAGCTTTATTATAATGATCTTGTATAGGCTGGTTAATCAGGAGTTTAA
TAATGA


>Contig19568.0.g85(protein)
MESNLTEPSKTNNIPSSSISSRDQKPAGEKSVNKSRKRSDSRRRSKERDRRDRDPKRGSS
RDRDRDHRHRRSNRSRSNERRRKRTHSRSKDRKKHHSSRKQSSSHRHRSRRSRDRKRRDR
SRSPKSSSSDSSSSSSSDGSASRRRQREAVKKRTRIQENVHPYFQRRKGQEEEPEQQNGA
LFWDGFQWVTRAQQVFDVAQNAVDKATKTVTGEDKQQNLERVAASRTVIIENIALDLGLT
AKDIQKFLLDHLTQIQEKDVEIIDVDMEYGPTSIAVELKEKWMVDKMKELDGIQCLGEKL
KVRRLNEETAQTNAIAAAITVAALKSLTSTGTGQDGEAELNLRAGSLKTVNPSSVIKISN
ILNREEELTPEIYEELYEDMEEEFKKGHHLKKIKIIRNGEDKLGAEVGSIFVEFMDKQSA
TQAIKRIKGRIYDGREVRVQYVDEKLYYNDLVQAGQSGVQQ