Identifiers and Description

Gene Model Identifier

Contig7534.0.g66

Standard Name

RRMX2

Aliases

Contig7534_0_g66

Description

RNA recognition motif 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam04059 ) RNA recognition motif 2
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004448801.999002769139511e-37RNA recognition motif 2 family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7534.0.g66(coding)
ATGCTGGGGAACAATACTCAGAATCAATCTAACATCAATAAATCTCACTAATAACAAAAT
TAGCCTGTGAGATATCCGCCACAGATGTTTAAATATTAGAAGCCAGGGGGTGCAGATCCA
GCCTAATTCTAGCTACACTATCAAATACCCCTTAGTCAATAGGCTTAGCAGTAACTCAAC
ATGCCTTTGTATCATTCGCAGCAGCAATATTAGTAGTAGCAATATATTAACTCAAGTGCT
CCTGAGTATTAAGTCAATAATATGATGTCTAAACTCTCAGTCAATGATATTCAATTATCT
CAACAAAGTATCAAGAATCATCTGTCAGGAGTGAGTGTTAGCAAACCTTCATCAATTAGC
CGTAAATTATTATTTAAGTCTAATACTCCTGTCAATACTAATCAAACACCCTAAGCAAAT
GATATGATTATCTCTAATCCAAATAATGCTCCTTCGTCATCAAACATTTTACAATCGACT
GATATAAAACAGCACATAAATCAAGTGGAGGGGTTAACGATTTCTTAGCAAGTAAGCTCA
TCTCCTTATTAGAACATGTAACCTCAACATGACTCAGTCTTTACGAGATCCTATGATAAC
TTCGACATTACATCTAGTAGAAATATGATGAATCCAGCAAGCTATAACTAACAATAACAA
ACTCTGTTATCGTAATAACAACTATTATCTTATTAACAGTAGCAAACTTAATAGCAACCA
GTTTATTAGTTTAATGCTCAGCAGTAATAGCAATAGCAGTAATAGTAGAAACTCCAATAC
TAGGTCTAATAACAAATACTCTCATAAACTGGATAGTATGGATAATAAACAACGAGGACG
TCAATCTAAAATCTTGATAAAAACACTATGAAAAACTAAAGAGACTTCAATCTTTCTCAG
CGAAATAATGCTCGAACAGGAAATGCTGGATAACTCGAGTAATTAAGCGGTTCTCAATCT
AATAGACCTTCATCTGAAATATCTTTTAGCCAAAATTAAACTCAATAGCTCACATCATTA
GACTCGAGCATTAAACGCTAATAAACTGTGCAACCAGCTAGAGGGAAGTCAAATGATGGG
AAAGGAGAAAGCAAAAATGAAATTATTATCAGTAACATCGATAGAGAAACAGTGGGGCAT
ATCATTCATGAAATACACTCCCATGGTGTCCAGGAAATTGATTACAAGCTAATTGAGTAG
AAATAAATCTTTATTGTAAAGTTCATAAATAAGGAATCAATAGACTGGGCAATAGAAAAA
TACGATGGCTAAGTGGTTAATGGTATGAAACTTCAAGTGAGACAAGTTACAGAGAGAAAA
AACTTCAGATTAAGGAATCATTAAATACTTCCACTTTCAAAGATAAACGAGACCAATGCG
GAAAGAGATGAGGATGTGGGCTCTGATGGGAGTAATTTGAGTAATTTGGAAGGTAATAAA
AGTTTAGGAAGTGGTAGTGGCAGTGGAGGTGCCACCTCTCAAATGACTCAAAACTAAGCT
CCACCAGGCTCAGTAAACCACCCTACCCCTGATTTGAACTAGATAAAGATGAGCTCGATT
GCTCAGCAAAGAGCAACTACTCCTAAAATATCTAGTGACAAGATAAACAAGGGAACAGCA
AGAGGCGATTTATAATATGGATATTAGACTACATCCAAATTTCCCGCAAATAATCATTAC
TAAAATCACTCTGTCTCTCCAAATTAGAGCTTTCAACAGCCACATAGCTCTAATGCTCCA
ATGATGCAAAGTATAACTGCCAGACAAGGTTACATTGCAAGCTCAGCTGAAGAATAATAC
CATAACCAGATTAGCCAAGCTGTTCTATTTAACATGCAAAATTAATAATAATTAATTTAT
AATGGAAACTAATCTCTTGTTGGATCCAGTAATTAAAATATGTTTGACTAGTATGGCAAT
GCACTAAATATGCAGGCTTTACATCAATCTTTTTATCAACAACCAATGGCAAATCTATCA
ATGAACAAACAGGTCTCATAAGGCTAGATGTCATTTTAGCAACACCCATAGTAAAATCAA
TCAATGAATAACTTTAGTTAATCATATCACCAATCTCCGCATTAAGATTTAAAAAGGTCT
AATAGTGGAATTTTAAAGATACATAACAAATTGGCGCATACCTTGAACAATAAAAAATAG
TTGGAAATAATAAATCAAAACATGAATTTAAGTATGCAAATCAATGCTGATTAATAGTAA
TAGCAAAGAAGTGATCAGCTAACCAAGAGTCTTAGCTTTTAGTTAAATACATAGAAGTTT
AAGAGCGACGATTTCGATGAGAAAGATTCTTATGATGAGTAAACTATAGATGATAAGTAC
TCTCAAGCTTTTGGTTACAATTCTTCTGGATCAGGTCTTCTTATCTAGCAGTAACCTTCT
TACTAGCAACAACAACAAAACTTGCAATAAAGCTTCCATGAAAACATTCCAAGCTTTGGA
AAGATAAGCGAGAGTATAGACGGTTCGTAGAATGACGAAATCAATTTACATTAGATAAAC
AATGAGGTTTCAATTGGCTCTGAAAGGGAAAGTTTTTATAATAAAACGACTAAGAACGCT
ATTAACACTTAAACTGTGAAAAATATCTCAACTAGAAGCGACTCAGATCATTCTCACTAA
ATTACTCATTAGATTATGGTATAATAGTACTAAAGTCCAGAGTCCACACAAAAGCTTACA
ATGACATAGAGAAACTATAACCTCAATAACTCCTTAGATTACATGCTTATGTCAAACTCC
GGAAGAGATAGCCCACAGAAGTTTAGCACTCCAGGCTCAAAGCTGAATAACTCTTTTCAT
CATTTTGGTTCATCTCAGAATTTAAGCAATTACATCAGGATTAATAATGAAATTCAAAAT
TCTTAGCAACAACACTAAGGAAATACAGGTCCCTACCATCACGCAAGAAATTTCTCAGCT
GAGTAGTAGTTTTATCAAAGTGAAGCAATGCAATACTAACATTACATGCCTTAGCCTTTG
AATTAAAGCAATCTGAATCACTCTATATCTATGCAATCAATGTAACAGTTCCCAAATTAA
TATTACAACTACTTGTCTACTTCTCAAGATCTTAATAACATCTCCCTCTATGGACATCCA
GTTTCAATGCAAAATACTCTAAATATGAGTGCTTCAAACTCTTCTGTAGATCTAGCAACC
AATCGAATCTCCATTTAAAATCGAAGCAGAATTTAAGGAGGGAACTAAAATCATTAGTAA
CTTAGAAGTGCATACAAAGATAGTGTTGAACCATAGAACGAAGAAAATTTTATCATAGAT
GATTGCAAAATAAAGGGTGGGGAAGACAAGCGCACAACAATCATGATAAGAAATATTCCT
AATAAGTACAAGTAAAAGAATCTACTGGATGAAATCAATCAAAATAATAAGGGAAAGTAC
GATTTTGTTTACTTGCCCATTGATTTCTCCAATAATGCAAACATTGGATACGCTTTCGTA
AATTTTGTAAACCCTTTGTTTATCTTGGAATTCAAAGAGGAGTTTGAGAATCGTAGATGG
AGAAAGTTTTAAAGTTAAAAGAAATGCGAGCTAAAATACGGGAGACTTTAGGGTATAGCT
TAAATTAACTAACACTTTTAGAATTCTACTGTCTCAAATCAAGTAGATGTACAAGTGCGT
CCAAGAATGTTTGATGAAAATTCTAGAAAAGATTGGACTAAAGAAATTCATAGACTTTGC
AATAAGTACACCTTAAACCCTTAGTTCTTCCTTGGATTCAAAAACAATAATAACCAATAA
TCTTTGTCAATGAAGCATGAATTTGTTTCAAGCATAAGTGTCAATAGCCAACAGAACATA
AGTATGCCTAGACTGGATAAATCAAGAAGTGTTGACACCACAAGTTCGCATGCTAATTAC
CAGCAAAACTTAAACACTACATAAATTAGCCAAATATAGGATATTCCTGAAGAGGAAAAA
GAATGA


>Contig7534.0.g66(protein)
MLGNNTQNQSNINKSHQQQNQPVRYPPQMFKYQKPGGADPAQFQLHYQIPLSQQAQQQLN
MPLYHSQQQYQQQQYINSSAPEYQVNNMMSKLSVNDIQLSQQSIKNHLSGVSVSKPSSIS
RKLLFKSNTPVNTNQTPQANDMIISNPNNAPSSSNILQSTDIKQHINQVEGLTISQQVSS
SPYQNMQPQHDSVFTRSYDNFDITSSRNMMNPASYNQQQQTLLSQQQLLSYQQQQTQQQP
VYQFNAQQQQQQQQQQKLQYQVQQQILSQTGQYGQQTTRTSIQNLDKNTMKNQRDFNLSQ
RNNARTGNAGQLEQLSGSQSNRPSSEISFSQNQTQQLTSLDSSIKRQQTVQPARGKSNDG
KGESKNEIIISNIDRETVGHIIHEIHSHGVQEIDYKLIEQKQIFIVKFINKESIDWAIEK
YDGQVVNGMKLQVRQVTERKNFRLRNHQILPLSKINETNAERDEDVGSDGSNLSNLEGNK
SLGSGSGSGGATSQMTQNQAPPGSVNHPTPDLNQIKMSSIAQQRATTPKISSDKINKGTA
RGDLQYGYQTTSKFPANNHYQNHSVSPNQSFQQPHSSNAPMMQSITARQGYIASSAEEQY
HNQISQAVLFNMQNQQQLIYNGNQSLVGSSNQNMFDQYGNALNMQALHQSFYQQPMANLS
MNKQVSQGQMSFQQHPQQNQSMNNFSQSYHQSPHQDLKRSNSGILKIHNKLAHTLNNKKQ
LEIINQNMNLSMQINADQQQQQRSDQLTKSLSFQLNTQKFKSDDFDEKDSYDEQTIDDKY
SQAFGYNSSGSGLLIQQQPSYQQQQQNLQQSFHENIPSFGKISESIDGSQNDEINLHQIN
NEVSIGSERESFYNKTTKNAINTQTVKNISTRSDSDHSHQITHQIMVQQYQSPESTQKLT
MTQRNYNLNNSLDYMLMSNSGRDSPQKFSTPGSKLNNSFHHFGSSQNLSNYIRINNEIQN
SQQQHQGNTGPYHHARNFSAEQQFYQSEAMQYQHYMPQPLNQSNLNHSISMQSMQQFPNQ
YYNYLSTSQDLNNISLYGHPVSMQNTLNMSASNSSVDLATNRISIQNRSRIQGGNQNHQQ
LRSAYKDSVEPQNEENFIIDDCKIKGGEDKRTTIMIRNIPNKYKQKNLLDEINQNNKGKY
DFVYLPIDFSNNANIGYAFVNFVNPLFILEFKEEFENRRWRKFQSQKKCELKYGRLQGIA
QINQHFQNSTVSNQVDVQVRPRMFDENSRKDWTKEIHRLCNKYTLNPQFFLGFKNNNNQQ
SLSMKHEFVSSISVNSQQNISMPRLDKSRSVDTTSSHANYQQNLNTTQISQIQDIPEEEK
E