Identifiers and Description

Gene Model Identifier

Contig13133.0.g4

Standard Name

RRMX19

Aliases

Contig13133_0_g4

Description

Domain of unknown function DUF221

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

  • ( pfam02714 ) Domain of unknown function DUF221
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam04156 ) IncA protein
  • ( pfam06024 ) Nucleopolyhedrovirus protein of unknown function (DUF912)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002649801.999002769139511e-37hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13133.0.g4(coding)
ATGGTTTTCCCTAGTTTAGCATGCTGTTTGAGAAGATGTGCAAAGAAAAATAATTACAAA
TCCCTTATGGCATAGGATGAAGAAGAAGATCTCAAGAGACTAGACAAAGTTGCTGATTAG
TTAGGAGTGTCAATTGATAAAGATGGAGATCTCAAGGCAGATTTGGATTTACTCTAAAAT
TAAGCAGTAACTGAGGACCCATATTTAAATCTAGGGTTTGGACTAGTTGCGTACTTTAAA
ATGATTAAGACCTTCATTTTCCTATTCTTCGTGTTTTCACTTCTCTCTATACCTGCAATT
GGAATATACAGTTCTCACAAGGGTTTGGAGGGTCTCTAGAATTATTCAAGAGCGAAGTTT
AGTCTTGGAAATATGGGCTTTTCTGATTCAATTTGCATGTCTATGTACTTGGGTGTAGAC
GGTCCTTAGTAAATATAGTGTAGAGAGGGTAAAATCAGCAGTTTATTCAGTTAAGGTATC
ATACCAAAAGTTAATAATGGATAAGAAGCTTATTGTGGATTGAGCTCAAAAGGCACTCTT
GAGATCAGTCAGTGCTCTGATAAATACGTGGATACCACAAAACTACAAACATATTTCGAT
GAAAATTGCAAAGATTAAGAGTCTTGTAAGACTCCCATTAACTTTAGAGACTATGTCAAA
TTTGGAGATAAGAATGACTGCACTGATGACAATGCAATATTTTATCTTCAATACTTCTGC
TTAGAAAATAATGATGGAGTCACTGCTAAAAGATAAGAAGCATTGGTTGTAGCATGCTTG
GGTATATTTATTTCACTCATATTCTTGTGCGCCATCTATTATTTGTTTGAAACTAGTAAG
CTAGAATACAAAACTTGGGATGTGAGTACAGTGACAGCAGCTGATTTTACAGTAGAAAGC
TTGATTAGTGAAAAAATGTGGAATAATTTCTTGTAATAGTATCAAGATAAGATTGATCCA
ACTGAAACACTTATTAACAAATTCCACACTCTATATAAAGCTGAAGTTGAAAAAGTTGCT
CAAGATGAGAAGGGTGTTCTAAATAATGCTGAAGATTAAGAAATAAGAGTCACCAACATT
ACCTTTGCCTTTAATAATGTTGATTTACTTAAACTTCTATCCCAAAGAGGTATGCTAGTA
ACTAAAGCTCTCCATGAAAAAGTGAAAGTTCTCGATTAAAAAATCAATCAACTCAAAGAT
TAAAAGAGAGATCAACTAACAAGACCAGTGGCAGCTTTCATTACTTTTGAAACTTAAGAA
GGATATGAGAGAGCTTGCAACATAAAAGGCAAGAAAAACTGGAAGAAAGAAATCGTAAAC
TCAAAGCACAAATTCTTTGATGATTACCTATGTTTCCAAGAGGCTCCAGAGCCAACAAAT
ATTATTTGGGAGAATAGAGATAGAACTTTCAAGCAGCAAACTACAAGAAAGATTATAGTT
GTTGCAATCATTATTATACTTCTGATAGCTGCTTTCATTGCATTTTATGTGCTTAAGTTG
CAAACTATTAGAAATTACTAAAAATATCCACCTGCCACTGATTGCAATTCAATATCTGAA
ATCTTTGGAGGAAATTATGACAATGCTAATTTTATCAAGTATGCTGAATAAGATAACTCA
CTTACTCAAAACAAAAAAGGTACAGGTATCTACTTCTGTTTCTGTAAAGACTACAGAAGT
AAATAGAACACTGATAAAAAGTATGAATTTTGTGATGACTATAAAAATGATTAGTATCTT
GGACTTGGGCTATCTAAATTTGTGTCAGTGGCTATAACTTTAGTTATAAAATCAAGTATT
TTCATAACACAATTCTTCAACACTGCTATTTTGCTTCTACTTACCAATGCTAACACATAG
TAAACGTTCTTGTCTTTCCTGCCTTTTGAAGGGCAATATCCAGATCTGACATATGAGTGG
TACAATGATATAGGGTCTTCACTTGTAATTACTTTGTTAACTGCTGCATTCTTCCCAATA
GCTGAGTTTTTCATAGCATGGGGAATGAAGACTGCTTTTAGAATTCTAGACAGAGGTTTC
TCCTGCAACAGAAACTTAACTAAGTGCAAAACAGTTTAGCAATATGTGAATTTATACTCT
GGTCCTGACTACATGATGCATGCAAAATATTCAGCAATGTTGAACGTCACATTTGTTACA
TTTATGTATGGATTGGCTATTCCACTATTGTTCCCTATTGCCTTTTGCTACTTCATTGTG
TTATATTGCGTAGAAAAGCTATGTTTGACTTATTTCTTCAAAAAGCCACCTATGTTCGAT
GAGAAGTTAAATGAAAGTGTTATTGCAACATTAAAATGGGCTCCAGTTTTTATGATGATT
TTTGGCTTCTGGATGATGGGAAACAGATAAATATTCTAAAATACAGTCCTTGCATCTGAA
TACAAAACTGACCCCACTCCAACTGATCATAAGGGTTACGATATCTCTGTTGATCAGTCT
TTACCATTATTCATTCTTGGAATCGTGATGTTCTTCTTCATATTTTTCAATGATCTGTTC
TTAAGTATCTTACAAAAATTGAGACTTGCCAAGGTAGATGAAGAAGCAGAAGTAGACGAA
TAGCTAGGTACTTATATTTAATGCTTAGGTAGAAAGAACAGACAAATTTGGAGAATTGAT
GAGACCCACTTAAGAAATGAGTTTGGTATTAAGACACTTACCGAAGATACGATTGCACAA
TTAAAAATAAACAAACCACACAATAAGATTATTAGGACATGCCCTAACTATGAGATTGTT
TCTAATTCAAAGTACTCTTAACTGTTCCAGTTCACACCAGTTGACATGAGGGATACAGCA
GAGGAGAAGTATACATCTGATATGGTTGCTAAAATGCTATATCTCGCCTATTTCTCAGAA
CATTAATAGAAAAATATTGTCTTCAAGGAAGGAGGAATCAAATCAAAGAAATACGAATTA
AAAGATTCTTCAATAAAAGAAGAGGATGATTTTAAGAGAGCTCCTCTACTTAGTAATGAC
ATTGAAGAAGAAGGAAAAAGTGATAACGCTATTTGA


>Contig13133.0.g4(protein)
MVFPSLACCLRRCAKKNNYKSLMAQDEEEDLKRLDKVADQLGVSIDKDGDLKADLDLLQN
QAVTEDPYLNLGFGLVAYFKMIKTFIFLFFVFSLLSIPAIGIYSSHKGLEGLQNYSRAKF
SLGNMGFSDSICMSMYLGVDGPQQIQCREGKISSLFSQGIIPKVNNGQEAYCGLSSKGTL
EISQCSDKYVDTTKLQTYFDENCKDQESCKTPINFRDYVKFGDKNDCTDDNAIFYLQYFC
LENNDGVTAKRQEALVVACLGIFISLIFLCAIYYLFETSKLEYKTWDVSTVTAADFTVES
LISEKMWNNFLQQYQDKIDPTETLINKFHTLYKAEVEKVAQDEKGVLNNAEDQEIRVTNI
TFAFNNVDLLKLLSQRGMLVTKALHEKVKVLDQKINQLKDQKRDQLTRPVAAFITFETQE
GYERACNIKGKKNWKKEIVNSKHKFFDDYLCFQEAPEPTNIIWENRDRTFKQQTTRKIIV
VAIIIILLIAAFIAFYVLKLQTIRNYQKYPPATDCNSISEIFGGNYDNANFIKYAEQDNS
LTQNKKGTGIYFCFCKDYRSKQNTDKKYEFCDDYKNDQYLGLGLSKFVSVAITLVIKSSI
FITQFFNTAILLLLTNANTQQTFLSFLPFEGQYPDLTYEWYNDIGSSLVITLLTAAFFPI
AEFFIAWGMKTAFRILDRGFSCNRNLTKCKTVQQYVNLYSGPDYMMHAKYSAMLNVTFVT
FMYGLAIPLLFPIAFCYFIVLYCVEKLCLTYFFKKPPMFDEKLNESVIATLKWAPVFMMI
FGFWMMGNRQIFQNTVLASEYKTDPTPTDHKGYDISVDQSLPLFILGIVMFFFIFFNDLF
LSILQKLRLAKVDEEAEVDEQLGTYIQCLGRKNRQIWRIDETHLRNEFGIKTLTEDTIAQ
LKINKPHNKIIRTCPNYEIVSNSKYSQLFQFTPVDMRDTAEEKYTSDMVAKMLYLAYFSE
HQQKNIVFKEGGIKSKKYELKDSSIKEEDDFKRAPLLSNDIEEEGKSDNAI