Identifiers and Description

Gene Model Identifier

Contig4501.0.g97

Standard Name

RRMX18

Aliases

Contig4501_0_g97

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4501.0.g97(coding)
ATGTATTCTAACAAGCCAACTTTCAACAGCGGAAGATACTATCATCAACCTTCAAGGTTT
GGTTCAAATCCAAACCACTACCTCCCCAGAAACTTCTTTGCGAAAGATTTTCACCACTAC
GGTGACGAATCGCCTAACGAGAGCCCCATCAACCCTTCACATAGCCAGAACCAATCTCGA
GACGAGAAAGCTGAGAGTTTCGAAGAAGAAAAGGCAACAGATCAGAAGTATCTTTTTGAT
GAGGATCTAGAGCAAAATTATGTATCTTTTCAAGATTAACAAAGGCAAAAGGGTAGTGAG
TTTAGGAACTAAAAGTAGGCCTATCATCATGACATTAAAAGTAGATAGTGGTCTGCTAAC
TATATTGACGATGAGCCACAGACCTCAAGATATCACTAACATAGATAGTACAATCAGCAG
TTCAGTCAAGAAGATAGGTCAGATTTTCAAAGTGATCAACTTAGATAAACACCCTTTCAC
ACTCATCAAAATTCAAAAGAGTTGTTCAACAGTCAAGATTAATCTGATCATCTTAATAGA
GGTTCGCAACCATATCACTCAAGAAACCCTTCTAGAAATATACAATAAGCTGTTCAAATA
AATCCTGAAATACAAGCAAATCATTTGAAGAAGTAGGAAATTGAGTAAAAATGCCAACTA
ATTTAGAAAAATTTAGCGTTGCTAAAACAAGAGCAAGAGATTTATGAAAAAGTTGAGCAA
ATTCTGAAAACTGTCTTGAAGATCTAAGATGAAGAGCATTACAAGAAATACTGTTTGCTA
TAAGTCTCCCTCCAAATCCTAGACAATTATGATAAGCTTCCCTCTTCAAGGTGCAAAACA
AATCTTTCGATTTATCAGCTTGATATAGAAGACCTTGTGAAAGCTTTCTCAGAGTTTGGA
AAAGTTAAAAAAGCTTATGTGTTGCCATATCCTAACAACAGGATTGGGTTTGTCTAGATG
GATTCCATTGTAAATTGTTTCAAAAGTATCTAAGCTCTAAACAATCAACATGTTGTGCAA
GACAGATGCATTACCTAGGTTAAGTTTGTGATCTCAAATGATATCCTTAGCCAAACAGAA
AAGTTATTCCACACAATAAAAGCAAGCAGAATCTAGAAGGGAAACGTCTTTGAGAAAGAG
CTAGATAAGTTGAAACAATAAGAAAATCAGATCAGTTCAAAGAATCCATACGACGCTCTC
CCAAAGTTTTCTCAAGTGTTTGAATCATCTAGATACTACAAGGAGTCAACTTATACTATG
AAGCAGCTGTAATCCATTCCATCCTTATACAACGAGTATGATATTTTCAAGCAAAACTAT
GAACCATTAATTCAATGCAATTAAGCTCCAGGCTTTCCATACTAGTGTTGGTTTTTTGTT
CAACTTGAAGATAAGCATATTCTGCAGATGGAAAAGAGCAAAACTGGAGGATAGAAAAGT
AAAAACTTGTTTGAGAGTCAAAGGCTAGAGAAGAACGAGGACATATTTTCGAAAATGTTT
ATTGGAAGACTTGGATACAATATTAGTGAAATCTTTGAGGATGTACAAGTTCAAAACGAT
AGAAATCTATTGAGAGTCTCACTATAAAATAAATGGGATAGGTTCAACTAATCTGACTCA
AACGATGCCCCTTTATTTGGATTCATACAGGCTAAGACAGAGCAAATTTTTGAGGATGCG
ATAGAAGCCACTTTCAAGCTTCTCAAGAAAACCTATATCAATTACAACAGGACATGCTGC
TTGAGAAAAACGGAACCAGTTGTCAAGAAAATATTCATGAAAGCATTTATAATGCCTCAG
ACTTTAAAGTAGATCAAAAGTGACATGAAGCTAACTTTAAGAAAGATCTCTTCGATTATT
GATAGTTCTTCTGTGTAGCCATTATCTTAAATTTAGAAAAACCATTAGCATGTCAATAGT
CGTAACAATCATAATGGCATTGGAAAAGTGAGCAATGTCTAGCCAATTTAAATGTTCTAA
TTTTAATCCTATCCTCCTTACTACTATCAATTTAATGCTGAGCAGTCTGTGAAATAATCT
CAAAGCAACGATAGTTTTTATGATGGATATCTTGATGATGACATGTATCTCTATGACAAT
CAGAGTATGAACTCTTACAGAGGCTCAAGAGTTTACCAACAGAAAAGCTTCATCAATCCT
CACTACTCAGGTAGCATCCATGAAGGCATGAACTAATCCTAGACTTCTTTGAATATTGCA
AACCCTTCATTCTACCCTAAGAAAACTCAAGCCTTGGTAGCTAAGGAATTCCCACAAATT
CCTGGGTAGGAATTTCCTACTCATTAAACAACTGAACTCCCTATCACTGTAGCATCTTAA
GTTATTGATTACTCTGTGCTCAATTCAATGTTGAATAATCAGCCTATCTTTGAAACTTAG
TCATCACCTCCTTAACACAATGTCCAAAGCCCTAATTAGACGACATTCATATCTCCTCAA
TAGAATCAAATTATCTACTCCTAAATTTACCATAAAACTTAAGAAAGATAAGAGTATGAT
CAAGTTTCTCTCAATGGTTCAAATGGACAGAGCAGCAGAAATCTCTACACATCGTTCAAT
TAGTTACAGCATTAGCAGTTTATCAATTAAAATGTGGCAAAAAAGACTCAATGA


>Contig4501.0.g97(protein)
MYSNKPTFNSGRYYHQPSRFGSNPNHYLPRNFFAKDFHHYGDESPNESPINPSHSQNQSR
DEKAESFEEEKATDQKYLFDEDLEQNYVSFQDQQRQKGSEFRNQKQAYHHDIKSRQWSAN
YIDDEPQTSRYHQHRQYNQQFSQEDRSDFQSDQLRQTPFHTHQNSKELFNSQDQSDHLNR
GSQPYHSRNPSRNIQQAVQINPEIQANHLKKQEIEQKCQLIQKNLALLKQEQEIYEKVEQ
ILKTVLKIQDEEHYKKYCLLQVSLQILDNYDKLPSSRCKTNLSIYQLDIEDLVKAFSEFG
KVKKAYVLPYPNNRIGFVQMDSIVNCFKSIQALNNQHVVQDRCITQVKFVISNDILSQTE
KLFHTIKASRIQKGNVFEKELDKLKQQENQISSKNPYDALPKFSQVFESSRYYKESTYTM
KQLQSIPSLYNEYDIFKQNYEPLIQCNQAPGFPYQCWFFVQLEDKHILQMEKSKTGGQKS
KNLFESQRLEKNEDIFSKMFIGRLGYNISEIFEDVQVQNDRNLLRVSLQNKWDRFNQSDS
NDAPLFGFIQAKTEQIFEDAIEATFKLLKKTYINYNRTCCLRKTEPVVKKIFMKAFIMPQ
TLKQIKSDMKLTLRKISSIIDSSSVQPLSQIQKNHQHVNSRNNHNGIGKVSNVQPIQMFQ
FQSYPPYYYQFNAEQSVKQSQSNDSFYDGYLDDDMYLYDNQSMNSYRGSRVYQQKSFINP
HYSGSIHEGMNQSQTSLNIANPSFYPKKTQALVAKEFPQIPGQEFPTHQTTELPITVASQ
VIDYSVLNSMLNNQPIFETQSSPPQHNVQSPNQTTFISPQQNQIIYSQIYHKTQERQEYD
QVSLNGSNGQSSRNLYTSFNQLQHQQFINQNVAKKTQ