Identifiers and Description

Gene Model Identifier

Contig14229.0.g47

Standard Name

RRMX16

Aliases

Contig14229_0_g47

Description

Zinc knuckle

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00098 ) Zinc knuckle
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13917 ) Zinc knuckle
  • ( pfam03618 ) Kinase/pyrophosphorylase
  • ( pfam05515 ) Viral nucleic acid binding
  • ( pfam07381 ) Winged helix DNA-binding domain (DUF1495)
  • ( pfam09805 ) Nucleolar protein 12 (25kDa)
  • ( pfam09548 ) Stage III sporulation protein AB (spore III AB)
  • ( pfam04906 ) Tweety
  • ( pfam05929 ) Phage capsid scaffolding protein (GPO) serine peptidase
  • ( pfam02601 ) Exonuclease VII, large subunit
  • ( pfam14392 ) Zinc knuckle

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14229.0.g47(coding)
ATGGCATCTCATTCATCACATTAAACTAATAACAGCAAATATGATAATTAAAACAATGTA
GTAAGATAACTTATAATCAGTGAGAAACGTTAGCCGAACAAGAAAGTGTATATAGGAAAT
ATTAACCCAGAGACTACCGATGAGGATTTAAGATTAACCTTTGTGAGATTCGGTGAGTTG
ACAAACGACAGTGAGTTGAAAGTCACAATGGCTTGGGTGAATGCTTTCAAACCTACTTTT
CAGAGCACATTAAATGAATTGGTCTCGAAAGGTATTGTTAGAAATATGGCTTCAGAAGAC
GATTGCTGCTATAAATGCGGGGAGAAAGGGCATTGGAGTGTGATTTGCACGAACCCAAAT
CCTTAAAGACTCAAGTAATTCAGAGAACAGAGATAGAAAGATTACTAGCAATATTTACAG
CAGAAGAAAGAGTACTATAATAAGTAGAGGGAGCTCAGAAATCAGTAGATGGTTGAGATG
CAATAATCAATGTATCAATAGTAACAATAAGCCCAAATCACAAATTCTACCAATAATGAA
CTTTCAAACTTAACTTCTCACCTCGAGTAAAGTGACACTTCTCAGCAGTAACCTCAAGCT
CTGGTGAGTAGTGGAGCTTAACAAACTTCATCAACTGGCACTAAAATAAAAACTATAACC
AATGTGAATATGATTCAATAAGACGATATGTTATATGGCATTGAGGTGCCAGGCTAGTTC
TATAATCAACCTCATCCAGGAGACTATAGGCCTTATTAAAAAAGGAAAAATTGGGTGAAA
TGCTTTAAATGCGGGAAAGCTGGGCATTATAAGACGGAATGCAGAGTCAAATATCCTGGG
GAGAAATCTAAAGTGGAATATCAAGATCCAAATTAATGA


>Contig14229.0.g47(protein)
MASHSSHQTNNSKYDNQNNVVRQLIISEKRQPNKKVYIGNINPETTDEDLRLTFVRFGEL
TNDSELKVTMAWVNAFKPTFQSTLNELVSKGIVRNMASEDDCCYKCGEKGHWSVICTNPN
PQRLKQFREQRQKDYQQYLQQKKEYYNKQRELRNQQMVEMQQSMYQQQQQAQITNSTNNE
LSNLTSHLEQSDTSQQQPQALVSSGAQQTSSTGTKIKTITNVNMIQQDDMLYGIEVPGQF
YNQPHPGDYRPYQKRKNWVKCFKCGKAGHYKTECRVKYPGEKSKVEYQDPNQ