Identifiers and Description

Gene Model Identifier

Contig20890.0.g83

Standard Name

RRMX15

Aliases

Contig20890_0_g83

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08777 ) RNA binding motif

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003187307.996041293534585e-17hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20890.0.g83(coding)
ATGGATTCTGACAAAAGAGGGAACCGCGATAGATCTAGAAGGTATGAACATAAAAATGTG
TTGATATTTTATAGTGGGAAGAAAAGAAAGTCTTCAAGCTCAAGTGACTCTGATTATACT
AGAAGACCTAAGAGACAAAAGACTAGTGGAGGAGGTGGCTTCTCTAATTTTTCAGATAGA
CCTCCTGAAGAGCAAAAGAACAAAATGTCAACATCTGAAATTTTGGAATATTACAAACAG
TATAATCCCAGCTAAGGGTTGACAAATCACAATAAAGCTGAAAGATAATTATATGTTGGA
AATATTCCACCAGGACTTGCTGTACCTTAAATTATGGAATTATTAAACACTGCGCTCAAG
GAGCTTGGTAAAGATGCTGGTATATTCTAAGAAGGAGATCCCATTGTAGGAGCTTGGATA
AGTGGAGACGGTCATTATGCATTTGTAGATTTTAGAACTGCTGAAGAAGCAACTCAAGGT
TTTGCACTTTAACAAGTGTCGATTCATGGAAATAATTTGAAAGTTGGTAGACCAAAGAAT
GCAACAGGTCCCATTCCAAATCCATCTTAATTGCTAGCAGGAAATCCAAACTTAATGAGC
GGCTAAAATGTAATCTCTAACAACAAAAAGAAAACGAATTAAGGTCTCAAAAATCTTTAA
CTTGGTGATTAAGGCAACTAAATAATTCAGGCTTTGAACACAAAAGTCATGGTGAGTAAT
TTCCCAGTAAATCACTCTAAGGAGAGTATACACAAAATCTGTGAAGTGTTTGGAAAAGTC
AAAAATGTAGACTTGCTTAAAGATATCACCACTGGCGAGTTCAAAGGTTAAGTTAATGTT
GAATTTGAAGATGAACTCGAGGCTAAAAAAGGTTATACTGGTTTGATGGGATTCAAAATT
GATGAGAAGGTATTATTTGTCAAAAGATTGACAACAATCAGTGCTCCAACCACCTAAATT
GAGGGAGAAGTTTTTAAGAACCTCATTGAAGATAAACCAACTGAATGTTTGATGTTGAAG
AATTGCATAATATTAGAAGAAATGACTGAAAGAGATGATTACAAAGATTTAGAAATAGCA
GTTGAAGAAGAAATGAGTAGATATGGAAAAGTTGTGAAAGTACACTGCCCTAGACCGCCC
ATCTTCGGTGACCCATATTCAGTTCCTGGCGTTGGAAAAGTTTATGTCAGATTCTAGACA
GAAGAAGATTCAGAAAAAGCTAAACATGGTATATACAAGAGAAGACTTAATGGAAGAGCA
GTAGATCCAGTTTATTACTCAGTCGAGAAATTCAATAAAGCATTATATGACTGA


>Contig20890.0.g83(protein)
MDSDKRGNRDRSRRYEHKNVLIFYSGKKRKSSSSSDSDYTRRPKRQKTSGGGGFSNFSDR
PPEEQKNKMSTSEILEYYKQYNPSQGLTNHNKAERQLYVGNIPPGLAVPQIMELLNTALK
ELGKDAGIFQEGDPIVGAWISGDGHYAFVDFRTAEEATQGFALQQVSIHGNNLKVGRPKN
ATGPIPNPSQLLAGNPNLMSGQNVISNNKKKTNQGLKNLQLGDQGNQIIQALNTKVMVSN
FPVNHSKESIHKICEVFGKVKNVDLLKDITTGEFKGQVNVEFEDELEAKKGYTGLMGFKI
DEKVLFVKRLTTISAPTTQIEGEVFKNLIEDKPTECLMLKNCIILEEMTERDDYKDLEIA
VEEEMSRYGKVVKVHCPRPPIFGDPYSVPGVGKVYVRFQTEEDSEKAKHGIYKRRLNGRA
VDPVYYSVEKFNKALYD