Identifiers and Description

Gene Model Identifier

Contig637.0.g43

Standard Name

RRMX14

Aliases

Contig637_0_g43

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam07194 ) P2 response regulator binding domain
  • ( pfam12353 ) Eukaryotic translation initiation factor 3 subunit G
  • ( pfam04156 ) IncA protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR159C0.0000009995106777214876NSR1 SGDID:S000003391, Chr VII
from 807656-806412, Geno...
T. thermophilaTTHERM_006574600.0000020007268868677913RNA binding motif protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig637.0.g43(coding)
ATGAGTAATTCTGCTAACTAAGTAAAAGGTACAATTTTCCCCAAGTGGTAAAATAACTTG
GAGAAAGATGCCGCCAAAATGCACGAAATTAAGCATGAAGTCGAGAAAGTTGAGTTCAAG
GGGCGTCAAAAAGTTAAGAAAGTAGTTGAAGTACGTTCTTTCTTGATTAAAAGAAGAGTC
ACTCAAGGATTTTTGGATAGATAGAAGATCAAGCCATTTGGTATTGGAAACAATGAAGAT
GATCTCAGACAAAATATTAACTTGACTTCAATTCAAAGAGAGAACGTATGGCATCCTTAC
TATGAATCTAAGGTAGAAGAGGAAGATTTTAAGGATAAGATCAGAAACAAGAAATTGGCT
GCACTTGAAAACGCAGGAAACTAAGATATCACAGAGCTCGAGAAGGCAATCAAATTATTG
GAAGAGAAAGACAAGCAGGAGCAACAAGACTAACTAGATGCTGCTTCTGGCACTAAGAAG
AAGATGTTCGATCTCAAGAGTCTTCAAGACAAGAAGAGAGAAGAGGATAAGTACGATTCT
AACATTCCACAGGAAGACCCATACACTGTCAAACTTAGAAATTTGTCCTGCGAAATCTCA
GAGGATGATATTTTTGAAGCCATGAAAAAGTTCGGAGAGATCATCAAGGTCAAGATTCCA
GTCGAAGAATTGAGAAATGGTAAAACAAGAATGTATGGCTTTGCTTTCGTCACTTACAGA
AATATCGACGAAGCTCAAAAGGCATTGGCTGAAAGAGAAGTTAACGTTGAGTATGCTACT
TTAGAAATTGAAAAGGCTTTAAAGAGAGCTGCCCCATAAAAAGAGGGCATGAACAAGATG
CAAGAGTTCGAGCAACTCAAGAGAAGACAGTGA


>Contig637.0.g43(protein)
MSNSANQVKGTIFPKWQNNLEKDAAKMHEIKHEVEKVEFKGRQKVKKVVEVRSFLIKRRV
TQGFLDRQKIKPFGIGNNEDDLRQNINLTSIQRENVWHPYYESKVEEEDFKDKIRNKKLA
ALENAGNQDITELEKAIKLLEEKDKQEQQDQLDAASGTKKKMFDLKSLQDKKREEDKYDS
NIPQEDPYTVKLRNLSCEISEDDIFEAMKKFGEIIKVKIPVEELRNGKTRMYGFAFVTYR
NIDEAQKALAEREVNVEYATLEIEKALKRAAPQKEGMNKMQEFEQLKRRQ