Identifiers and Description

Gene Model Identifier

Contig3127.0.3.g31

Standard Name

RRMX13

Aliases

Contig3127_0_3_g31

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3127.0.3.g31(coding)
ATGTTCAAGTAATTGACAAGACTCTCAACTAAAAATCAAGTTAGAGCAAGCTATACTGCT
TCAAATGCAGTTTTATCTTAGGTTGTCTAGATGAATCAAATCACAAAGACAGCTTTGATC
TCAATTAGAGCATTTGGCGCCTAGATGAGTCAAGTTTAAAAAGACTTTAGAACTGTACCC
CTCCCTCCTATAGGTGAATTTGCGACACCTTAAATCGAAAAGAGAACTAGAAATATCAAT
AAAATCATTTCTGATTACGCTGTAAGTGAAGACGACCTCTCCCTCAAGTTGTCAAAGACT
ATACCTGATGAGGTATTGCAAAGCCATTAACATCCAACAGAATACATCTTCTAGGAGTAA
AGAGTCTCATTAGACTATGCTAAATAAATGACGGATAGAGACGTCTTGCTTTTCAATCTG
CCATAAAACTACACTGTTGAGCAGGTCAAGGAACTTTGCAAAGTGAAAGGAACCAAGGTG
CTTGAAATATCAATTCAGAAGACCATAGATGATGAATCAATTGCCTGTGTCAAGCTGACC
CTCCAATCCACTCCACAAGTCAAAGTATTCTAGTAATCACTCTATAACACCTGGATTGGA
GACAAGAAGCTTAAAATCTAAAATAAAAAAGAAGCAGAGAATGAAAGTTTTTCACTTAGA
ACTGTCATTGTAACAAACCTCCCAATTCATTATAGAGCTGAAAACCTCAAGAAACTATAT
AAAAGCTATGGAAATATTGTCAACATAGAAATGCTTTTTGAGGACGTAAATATAAAGGAG
CATATGAAGAACAAGTAAGACCACTTCTCCGAGTAAAAGAATGAGAGAATCCAACATGAA
ATCAATAAAGCCTAGCAAATAATCAAAGACAGTATTTAAACCGATCAGGAGTACTAACAA
TTCTTGAGAAGCCATTTAGGTCAAGAAGAAATTGAAAGAGTCTTCTAAAATCAAGGCTAT
ACTAATGATTCTAATTAAGTTCATGAAAATTAAATGAGTGTGCTTGACTCACAAATAAAC
CTTAGCATTCATAACCTCATGACTTAGCTTCAAAGAGAGTCAGCAGATATCAGCGATTCC
AAATAACTTTTACTTAAGCTAAAGAAAGATTTGGAGAGTGAAGTACCAAGCATCGACACT
CAGTCAGCTAAGCAAGCTACTTAATTTACTAAGGTTGATAATGAAAGAGAAGCTGTTTTG
AGACTAGTTTAATACGTTAACAGAAACAGAGAGTAAGTTGATGATGATGTTCTTTCTGCT
CTGAACGAAAAAATTAACTTCAACACTCTTGGGTCTCCATAAGATCCACTTCAAAGATTA
GAGAACCTATCAAGACTTGAGTTAGCTGAGGCCTATGACAATTTATATAACGTTCTTAGT
GCTAGAGAATAATTACTAGAAAAGAGATTTTAAGAACAATACAGACACTTTGGCCTTGAA
GAGAGAATTCTCTTTGGTAGAAGAGACTGGTCAAGAGAAAATGAGATGGTCAAAGATTCA
AACGATCCTTTCAACATGAAGACAACTCCTGAGGACTTTATTTCAGTGACAGAACAAATT
CATGATGTTCTCCATGCCAAGAATCTCACTCCTGAATAAAAGCTATTCTACGTGGTTACA
GGCAAAATGAACCCTTTCAAGAAACTCAATTTTGATAAGAAACATTTAGCTACATCTATG
AACCCAAAGCTAGCTCAACACAGAGTCTATCCAGTAATGGATCCAACTCTCACTCCTACA
TAAAACAGAGAGAAAAATCCTTATTACCATCTCAGACCTTCAGCTCAAGAAGTAGCTAAT
GAAGTAGTAGACACATTCAGAGAAGAGTACGACATGCCATTTGATGAGCTCTATCACAAA
GAAAAGTCTTTAATTGACAATGTGATTAAGGCTTTCAATGACCTCAAGCAAAAAAGAGAG
AGATTGCCAAACCCTGTTGGAGACAGAAACTTCATTGAGGCTGGTGAAGTGCCAGAAGCT
GTACTCATAGCTGCTAATATGCACTCCGAAAGTTAATTCGTCAGAGATCAAAGAAGACAA
AATGAAATGATCATGAAGAACTCCCTTGATGGAGATTCAGCTAATGCTGGCAACTACTAA
TATCTCATGCAACATCAAGATGAAATTGATAAAATGTTCGATAATGGAGAAATATCGAAG
AAAGATTATCAAATCTACAAAAGCATGGTTGATAACTTTAACAAAGTGAACAAGGGTTAT
GCTTTTATCACTTTCTCTCACTCAGATGAGGCTTTAATAGCATAATTTGGTTCATAGTAC
TTAGTTGCTGATAACAAGCTCCTAGAAACTATTCCAATGGGAAATCTTGATCACAAAGAT
CTAGATAAGAATTTCGTTATCAACGAAATGAAAAATGATTCCAAGCTCGTCAATGAGATT
GAAAGGCTAAGAGAAGCCAAAAAAGAACTTGACACATTTGAAAAGAACATTGATAAAGAC
CTGCCCAAGAATATAAGGATGAATGAATTCAGGAAAATGGCAAGAGATTACATTGAGAAC
TCTTAACAAAACGATAGAGATCATATCCGTAGAACACCATTAGAAGAAGAAGAATTGAAT
GATAAAATCAGGTAATTGTAGAAATAAAATCCAGATATTGACCTCACTCAATTATTCGAT
ACCGAGAGAAACGAATAGATTAGAAAAAATCAACATAAGAAGGCATTCTAATCCTATAAA
ACTTTCCAGTTTTTGAAGAACGGTGTTGAGTTCCAAAATAGAAGAAAGCAAGAAATGGCT
AAAAGAGAGGAAATCTAATAAAACGGAGTGAAGGCTAAAGATGCTCATAAATTCCCACCT
ATTGAAGAGACATTAGCTCAGTTTGTTAGTAAGGATGGTAACTTTGGAATTTTGAATGAT
GTTCAATCCTTTGATAAACCAGGAAGAAAATTCAACTATAGTGAAAATGACTTTGTTGAA
AGCTATTTTGGAAAAGACGGCTTGAGAAGATTAGGTTTTGAAAATAAGCCTGATAATAAT
AGAAGTAGCATCTTCGGTTTTAATGAGACTTGGAAAAATAGATTCCAAGTGGAGAAATAC
CTTTTAACTCCTGAAATCGAATAGAAGCAAAGAAGACTCGATGAGACTTCAGCCCGTGAT
CAATAAGACTTAGCTAAATCAATAGATTTGGAGTTTGAAATGCTGTAACAAAGTTTTGAT
GTATCCAATCCAAATCACGTTTAGTACAGAGATAAAAAGCATCCCTCTCAACCAGGCAAA
ACTTACATGAGTGATCTTTAACAAAAAATCGAAAGCTACTCAAAGAGAAGAGATCAAATT
GCTGAAGATAAGAAAGATGATCCAGTGTTCAAGCCCTCAGATATTGAGATGATAAAGTAT
ACATTGAATGAAGAGTATTATCCCAAACCAGTAAAGAGGGGATAAGAAGAGGATACCAAA
GCAACTGAGAAATTCGAACCAAACTATGAAGGCAAGAGAAACCAAGATAATAGTGACGAT
TCAGATGATGATGGTAATAATCAGGAAGATGATGCTAATGAACCTACTGGACAATACATA
GATCCATCTCTAAGAAGAGCCAACAATAGAGTTACTTATAAATATAATGAGCACTTATCA
AACAACCCAGACTATGACAGTCAAAAGGATGGAAATGAAACTCTTTAAAGATATGAGAGT
ATTGCAGAAGAAAACAGTATGGATACAAGTGAATTGCTTGATAAGCTGAAAAGATTTGGG
CCACTAGATGAAAAATTAAATGGGGATGGTTAATTCATGAAGAAAGAAGCAGCTGGTTCC
CTTAAATCTGACTTTGACATTAAAGGTAGACAGAGACAATCAAAATCTCTGTAGACTTTC
GTTGAGGACTCAATGAGTGAAAGAGAAGATGAGGATATTTACTCTCACTATTTCAATAAG
ATGAACGAAGCCAAGAAATAGTAGAAGGAGGAATAATCAAAGTTGAATAAGGAATAGAAG
ATAGCTTTAGAAGAAGCAAATAAATTCTAAGATATGTTCCCAGAGATTCCAAGATTCTAA
GGATTTTTCAAGAGTTAAGCAGAGGGTAAACATCCATTTGAAGACAGTAAATTTGATATG
CCCGAATATACTCAGTAAGACAAAGAGAAGCAACTTGCTAGTGATGAATACTTCGAAGAG
CTTTATCAAAGAGAATTGAGCGGTAGATTATTGGGTGGTAATTTAACACCAAGACAGTTC
GCCATCATGTATGGTGCAACCGGAGATGATAAATTGAAGATCAAACTACAACAAGGCAAT
GATAGAGAATAATCTAAAGAGAACAGAAGACATGCCGCTTTACTTTTGGAATTAAAGGAA
TAATACAGAAGAAGAAAGGTTTTGAGTGGAGAGTGGACCGAGGCTGAGAGCAATAAAAGA
CTTCATGAGGATCTCTAAGAAAAGATGAATAAAATGTTAGAGAACAAAGACTATGATAAA
GAAATGAAAGAGAAGATTGAAGCCGAATTAATGTTCAGAGCTACTATGGTTCACCAAAGA
CTCTAAGAGAAGGAGTACTACTTTGATGAAGGCCTTGGAGTTAGTGTAAACGACCACATC
AAGAAAATTTAAAGAGATTTCCCCGATCTTGAGGTATCCGTAAGAAGAGATAGAGACGGC
TATCCAGTTATCAAGACCTTGTACAAGCCAAAGTTCAAGTACAACTTAGACTCATTCTTA
AATTTTGATGCCCAAAAAGAGCACTAACATCTCAAGGAGACAACTGAAATTTTACTCTCT
ACTTTGTTGCCATTAGGAAAAGGAGCAAAGGATTTGAGTTCATTGACAAAGGAGCAACTC
GAACAAAGCTTGTAGACTCTTATGCCATACAACTTAAACAATCAAGAGCGCTTTGACTTT
GATGCTGCCACTCATTAAAAGCTATCCAAGCTTGTTGATGAAAGAATGGAGGGAAGATTC
AGAAATGATTCTGAAGGATTTGCTTAAGCAATTCTTAAGTTTAACGAAACTGCTACATAC
GATAAGACAAGAAGAATCAATGACTCAATTAGAATTGCCAAACCTAAAATTGACTACAAG
GAAACCTTTGCAAATATTGACTAAGAATTCGACACAATGTAAACTGAACTCATGCAATAG
ATTATGATGAGAGTCAAGGATCACTTGTATGCAACAAAGAAGAAGCAAAGTGATTTCGTT
AAGCCTAGAAGAAGTGAGATTTCAATCTAGCAATCTTTAAAGCGATGCTGA


>Contig3127.0.3.g31(protein)
MFKQLTRLSTKNQVRASYTASNAVLSQVVQMNQITKTALISIRAFGAQMSQVQKDFRTVP
LPPIGEFATPQIEKRTRNINKIISDYAVSEDDLSLKLSKTIPDEVLQSHQHPTEYIFQEQ
RVSLDYAKQMTDRDVLLFNLPQNYTVEQVKELCKVKGTKVLEISIQKTIDDESIACVKLT
LQSTPQVKVFQQSLYNTWIGDKKLKIQNKKEAENESFSLRTVIVTNLPIHYRAENLKKLY
KSYGNIVNIEMLFEDVNIKEHMKNKQDHFSEQKNERIQHEINKAQQIIKDSIQTDQEYQQ
FLRSHLGQEEIERVFQNQGYTNDSNQVHENQMSVLDSQINLSIHNLMTQLQRESADISDS
KQLLLKLKKDLESEVPSIDTQSAKQATQFTKVDNEREAVLRLVQYVNRNREQVDDDVLSA
LNEKINFNTLGSPQDPLQRLENLSRLELAEAYDNLYNVLSAREQLLEKRFQEQYRHFGLE
ERILFGRRDWSRENEMVKDSNDPFNMKTTPEDFISVTEQIHDVLHAKNLTPEQKLFYVVT
GKMNPFKKLNFDKKHLATSMNPKLAQHRVYPVMDPTLTPTQNREKNPYYHLRPSAQEVAN
EVVDTFREEYDMPFDELYHKEKSLIDNVIKAFNDLKQKRERLPNPVGDRNFIEAGEVPEA
VLIAANMHSESQFVRDQRRQNEMIMKNSLDGDSANAGNYQYLMQHQDEIDKMFDNGEISK
KDYQIYKSMVDNFNKVNKGYAFITFSHSDEALIAQFGSQYLVADNKLLETIPMGNLDHKD
LDKNFVINEMKNDSKLVNEIERLREAKKELDTFEKNIDKDLPKNIRMNEFRKMARDYIEN
SQQNDRDHIRRTPLEEEELNDKIRQLQKQNPDIDLTQLFDTERNEQIRKNQHKKAFQSYK
TFQFLKNGVEFQNRRKQEMAKREEIQQNGVKAKDAHKFPPIEETLAQFVSKDGNFGILND
VQSFDKPGRKFNYSENDFVESYFGKDGLRRLGFENKPDNNRSSIFGFNETWKNRFQVEKY
LLTPEIEQKQRRLDETSARDQQDLAKSIDLEFEMLQQSFDVSNPNHVQYRDKKHPSQPGK
TYMSDLQQKIESYSKRRDQIAEDKKDDPVFKPSDIEMIKYTLNEEYYPKPVKRGQEEDTK
ATEKFEPNYEGKRNQDNSDDSDDDGNNQEDDANEPTGQYIDPSLRRANNRVTYKYNEHLS
NNPDYDSQKDGNETLQRYESIAEENSMDTSELLDKLKRFGPLDEKLNGDGQFMKKEAAGS
LKSDFDIKGRQRQSKSLQTFVEDSMSEREDEDIYSHYFNKMNEAKKQQKEEQSKLNKEQK
IALEEANKFQDMFPEIPRFQGFFKSQAEGKHPFEDSKFDMPEYTQQDKEKQLASDEYFEE
LYQRELSGRLLGGNLTPRQFAIMYGATGDDKLKIKLQQGNDREQSKENRRHAALLLELKE
QYRRRKVLSGEWTEAESNKRLHEDLQEKMNKMLENKDYDKEMKEKIEAELMFRATMVHQR
LQEKEYYFDEGLGVSVNDHIKKIQRDFPDLEVSVRRDRDGYPVIKTLYKPKFKYNLDSFL
NFDAQKEHQHLKETTEILLSTLLPLGKGAKDLSSLTKEQLEQSLQTLMPYNLNNQERFDF
DAATHQKLSKLVDERMEGRFRNDSEGFAQAILKFNETATYDKTRRINDSIRIAKPKIDYK
ETFANIDQEFDTMQTELMQQIMMRVKDHLYATKKKQSDFVKPRRSEISIQQSLKRC