Identifiers and Description

Gene Model Identifier

Contig12713.0.g71

Standard Name

RRMX10

Aliases

Contig12713_0_g71

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002856809.001232279470736e-16hypothetical protein
SGDYER068W0.00000000009001903211590313MOT2 SGDID:S000000870, Chr V f
rom 293050-294813, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12713.0.g71(coding)
ATGTGGAGACCATCCAACTAAAACATGAGAATGATCAACCACTCAATCCCTTTTGAGTGT
AATTTTGCTTAAGTATGCAATGACTGTGAGCTTGAGTTTCCAACTAAGAATCATCTGGTC
ACATGCAAGTGTTCTAACATAAAGTGGTGCTTAGACTGTGCTAAAAATCACTTTGATGAC
CAGATTTCATCATCATCTACCAACCAAAACTCAATGAATCAATCGTATGATCAATACAGA
TGTGAAAGATGTAACAAGGTTGTTTAGCTTCAAGCTTTTAGTGATTAACTCTCCTCTATT
TCTTCACTCAGTTCAATTCATTGTTATGGATCACAAACCTCAAAGAAAACATAACTCAAG
CCTCGTAAGATTGAACCACTAAGACCAAGAGACACACAACTTGTTGAGTCACTTCTCAAG
TTCAGAATCGTTCAAGAAAATTTGCTATATGTGATTGGAATCCCTGAGAAATATGCTGAT
GAAAATCTTTTAGCCTCACAAAGATATTTTGGACTCTACGGTGAAGTAAAGAAAATCAGA
ATCAATCGCTGCCCTAAGGACTCCTACGAAGGTTAGTGTGCCATATATGTATGGTACTCT
CATCCAATACAAGTAGCCGTCGCTATCAAGTGCCTTTCAGGACTCAAGTTTGGAACAAAA
GGTGCTCTGAAATGTTCATACGGAACATCAAAGTATTGTGCTAATTTTCTCAAAGACTCA
TACTGTGAAGCCTTTGAAAGTGAAAAGTCCTGTCCGTTTCTTCATTACTTAGAAAGAAGA
AGGGATAAAGTAATTGAAGATGATCCTGAGTTTAGAGAATACCTCAACTTTCAAGACTCA
ATAGTTGAATCTTTCATGTATTTGCTTGGAATCTAAATTCCATAAAGTGAATTGCAAAGA
TATTAAGACTATCTCTAAAAACCCTCGGATCTTGGATTCCCAAATCCATTTGACTTACTT
GGCAACAGAGTAGAACCTGCAATCACTATGAGAATAGATTAATACCTCTTTAAGGAGTTC
AACAGAGTCTAGTATCTCTTTGTCAAAGACAATGACAACTCTTTGATGGTGACAAAATTC
TACTATCTCCCAGAGCAGTAATAGTATGATTATTACTCTGACAATAATGAAAGATTTTCC
GAAATAATGCTTCCATCGATTGAACCAGTCTTTGAAGTGATTGAAAAGTCTACATCAAAG
AGTGATCAAGGTAGATGTATTCAACCATTCAATCTCTAAGATTAATAGAAATCACTCCAA
AGCAATGAACTCAACAAAGAAAATCTTCTAAAGCTGTAGCAGTCCATCAATTTTAATGGA
ATTTAGAAGTCAGGTTAAAAGAAAAGAACTATCAAGACCCATCACAGCCCTAGGATTTTT
GAATACATAGCTGAGTAAAACTATCCCCGGCACTTGAAGCCACAAATTCAACAATATTCT
ATGAATGAGCGCCTTGGTTAAATGAGTTAACTTTAAAACAGCTACTTAGTTTGTACAATT
CCAGCAAATGGTTAATAAAACTTCTAATCAAGCTGTAGATATGAGTAGTAGTTTTCAGGG
CAGTCTTAGAGTTAACCAAGCTTTGCACCTTTGAGATATCCATTCAATCAGATTCAAGTC
TAACCTAGTTTTGATCATCAAGTGAACTAGCAAGTTTACATTTTCTAGTAGTAACTATAG
GCAAATCAAAGATCAACTCATGCAGCTTAGGAACCTTTTCAATACACAAGCCAAAGGTCA
ACTCAAGTATCCTAGGAACCTTCTCAACATTCTTTAAGTCAGTCTAGTATGTATAGTTAA
GCTTCAAACATTGAAAAATCTTCAGATTTAAGATCAATCGATGTCCAAACATAGAACACT
AACTGGTTAAGTTCAAAGGAGTTTGTTCCTAAGAAACTAGAAAAGCAAGCTTCAGTCATA
AGCTCTGTGACTTCTTAAAGTGCAGATTCATGTTTAACTACTCCCTAACTTAAAGTCTAG
AGCAAAATCAAAGAGTATTTTGAGTCAACTGTTGTTAACCCTGAAAGCGATCAAGAATCT
TCATATCCAGCAAGTAGAAAAGATTCAGAGATCACTATACTCGATGTTTCTGAAGTCCAT
GAAAAGAGCTTTGTTTTCATTCCTCAAACCTCTAAGATACAATATAAAGTTTTTTAGAAT
GAATAGCAAGGTAATTCAGAATAAGAGATTCTTGAAGGAATGACTGAATCTATTTGCCAT
TTTGTGGTAAACAATGTATTGAAAGATGATGAAATTGAAAACATTCAATCAAAAAGAATG
TCTGATACCTCAATAAAGTAGCAAACCATGGATCTATGTGCGATGAAATGTTGGTTTAAG
CTTTGA


>Contig12713.0.g71(protein)
MWRPSNQNMRMINHSIPFECNFAQVCNDCELEFPTKNHLVTCKCSNIKWCLDCAKNHFDD
QISSSSTNQNSMNQSYDQYRCERCNKVVQLQAFSDQLSSISSLSSIHCYGSQTSKKTQLK
PRKIEPLRPRDTQLVESLLKFRIVQENLLYVIGIPEKYADENLLASQRYFGLYGEVKKIR
INRCPKDSYEGQCAIYVWYSHPIQVAVAIKCLSGLKFGTKGALKCSYGTSKYCANFLKDS
YCEAFESEKSCPFLHYLERRRDKVIEDDPEFREYLNFQDSIVESFMYLLGIQIPQSELQR
YQDYLQKPSDLGFPNPFDLLGNRVEPAITMRIDQYLFKEFNRVQYLFVKDNDNSLMVTKF
YYLPEQQQYDYYSDNNERFSEIMLPSIEPVFEVIEKSTSKSDQGRCIQPFNLQDQQKSLQ
SNELNKENLLKLQQSINFNGIQKSGQKKRTIKTHHSPRIFEYIAEQNYPRHLKPQIQQYS
MNERLGQMSQLQNSYLVCTIPANGQQNFQSSCRYEQQFSGQSQSQPSFAPLRYPFNQIQV
QPSFDHQVNQQVYIFQQQLQANQRSTHAAQEPFQYTSQRSTQVSQEPSQHSLSQSSMYSQ
ASNIEKSSDLRSIDVQTQNTNWLSSKEFVPKKLEKQASVISSVTSQSADSCLTTPQLKVQ
SKIKEYFESTVVNPESDQESSYPASRKDSEITILDVSEVHEKSFVFIPQTSKIQYKVFQN
EQQGNSEQEILEGMTESICHFVVNNVLKDDEIENIQSKRMSDTSIKQQTMDLCAMKCWFK
L