Identifiers and Description

Gene Model Identifier

Contig2840.0.g48

Standard Name

RRMX1

Aliases

Contig2840_0_g48

Description

RNA recognition motif (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam05172 ) Nup53/35/40-type RNA recognition motif
  • ( pfam07576 ) BRCA1-associated protein 2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008218803.001003044337619e-17RNA-binding domain protein
SGDYER165W0.00000000002000577768187062PAB1 SGDID:S000000967, Chr V f
rom 510373-512106, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2840.0.g48(coding)
ATGAAGCACTTATTAAGCAAACAAAGAGGAGTCTTTGGTACATTTTTGAATTAAACAAGA
CAAGCTCATCAATTCTAAATGACTTTTAACAATGGCCTACTCTTCAGAACAATCACATCA
AGAATTTTCGTGGAAGGTCTACCAGCAGATTTCAACACACAAGAGATAGCAAATCACTTT
AAGCTAGCAGGTGAAGTTTAAGACGTAAACCTTGTAAGAAACAGTATGGGTTAAAACACT
GGCAAGGCCCTAGTCACTTTCAAGTCTAAATCCTCAGCCGATTAAGCTCTCCAGAAGTTC
AATAACAACGCCGTGAATGATTTGATTTTGAATGTGAAACCATATCTTGATAAAAAGGGT
GATTTGACAGCTCGCACAATGCCAGAACTAATCAAGAGAAGAATCTATTTAATGAACGTT
CCTTATGATGCTCATCCTTAGGAAATTGAAGCTTTAGTTAAGCAATTTGTTCCAGTTGAT
GAAGTTGTTCTCCCAAAAGACAGATCTGGAAGACCAAAAGGATATGCATTTGTTTACTTG
AAAGATGCAAGAGACCTTGATAAAGCAATTGAATATATCGATGGAAGACACATTAGAAAC
AGACAACTAAGAGCTTAGAAGTAACTAACTATTGGGCAAACTCAAGAACCAAGCTCTATG
GATGAAGTGGAATCTGAACAAGCAGTTAAATACATAAAGTTTGTGAGAAATTCTTACTTA
GTGAATGCCATTAGCGAGTCTCCAGAAACTGAACATCAAAACAAATAACATAACACAGCT
TACAGAGACTTAGTCCTCACTTAAGTTGAAATCTATGCTAGAGAAAACAATCTTTCACTT
GAAGAGTCTCATGAAAAAGTACTTTAATAGCTGAAAGAAATGGACAATTCTAACGCTGTC
TAAAAATTACAAGAGGAGGTTTAGCTCTCAAGATAAGCCAGAGACAAAGCTCACTCTAAA
TGGACAGAGGAGGAGCGTAACAAATACCCTGCTACCTACATGGCTGAATAACTTCAAGAG
CAATTAATGGAAGCAGTCAATTTACCAAAGGAACTTTTATACCCTGGAGAGAAGCAAATG
CACAAGCCTTTGGTTAGGAGACAAGTAGACATGTCAGCATATATTTGA


>Contig2840.0.g48(protein)
MKHLLSKQRGVFGTFLNQTRQAHQFQMTFNNGLLFRTITSRIFVEGLPADFNTQEIANHF
KLAGEVQDVNLVRNSMGQNTGKALVTFKSKSSADQALQKFNNNAVNDLILNVKPYLDKKG
DLTARTMPELIKRRIYLMNVPYDAHPQEIEALVKQFVPVDEVVLPKDRSGRPKGYAFVYL
KDARDLDKAIEYIDGRHIRNRQLRAQKQLTIGQTQEPSSMDEVESEQAVKYIKFVRNSYL
VNAISESPETEHQNKQHNTAYRDLVLTQVEIYARENNLSLEESHEKVLQQLKEMDNSNAV
QKLQEEVQLSRQARDKAHSKWTEEERNKYPATYMAEQLQEQLMEAVNLPKELLYPGEKQM
HKPLVRRQVDMSAYI