Identifiers and Description

Gene Model Identifier

Contig1235.1.g124

Standard Name

RRM38

Aliases

Contig1235_1_g124

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam07744 ) SPOC domain
  • ( pfam08695 ) Cytochrome oxidase complex assembly protein 1

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER165W0.00000030014504373857585PAB1 SGDID:S000000967, Chr V f
rom 510373-512106, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1235.1.g124(coding)
ATGTCAAAATTAATTAGAAGCGGTAGCGACATTTCGCCTAAGGAGCAACCTTCCTTGGCA
AAGTCCCATTCAGCTTCTTCTCACAAAAGGAGTAGATCACGAGACAAAACTGACTCAGCT
ACTTCCTTGAGACGTAGTGACAAAGATCAAAGCTCAAGCTAAATAAAGGAACGCGATTAA
GAATTGCTAAAAGATAAAAAGAGCGAAGACCGCGGCCGTAACAAGTCGAGGTCTAGAAGC
CCACACCATACGAGTGGTGGGGGAGGGGGTGGTGGAAACATAGAGAGGTTCCCAGGCTCA
GGCCAGGGCTCCTCAACTGCGCTAAGCAGCAAACACGATAACAGTGGTCGAAGCGCTAGT
GAAAATAAACGCAGAGACGATAAGAACCAAGCAAAGAAATCGACAGATCAAGAATCACCA
AAGAGAAAAACTAAGTTATACATTAGAGATTTGCCAATTGACACTACCGAGGACTATATT
AAATAGGAACTTAATAAATACGCTCAAATAGTCGAAGTAAATATCAGAAAGCGTGAAAAA
AATAACACCGTCTAAGTCATGGTTCTAATAAAAGGAAGTTAAAGAGATGGTGAGAAAATT
AAGAGCAGCTTGAGAGATAAGAAAAAATGGGAAATAAGTGTTTAGGAAGTTGAAGTGGAT
AGAAAAAGTTCAAGATCTAGGGAAAGAGATAGAGAAAGAGAAAAGCAAAGAGATCGTGAG
AGAGAACGAGATAGATTAAGAGACAAGGAGAGGGATAGAGATGTGAAAGACAGGGATAGA
AAATAAAGGTCAAGAAGCAGGGATCACTAACATAGAAACAGGAAATCCACATCCTCGTCA
GAAAAACGTCATAAGAAACGGGATCAGCAAGGAAATAGCAGATAACACCACAATCATGAA
AGGGATAACTCCAAATCTCATTCACACAGCAATAACCGCCAAAACGGTAAAAACTAGAAT
GAAAATAATTCTAACAATAAAATTCCTAAAGAACTCAGTGAAAAAGATGATTCAGTGACT
ATAGTTGTCGCCTAAGGTCCAAAGCCAAGAGGAGATGTGAGAGTGAGAGAGCTGTGGCTT
GGTAACTTACCAGAAAATATTAGTGAAAAAGTTGTATACTCCCATTTCTTCATCTATGGC
GATATTGAGAAGATTGAAATGAACTAACATAAAAGCTATCCCTATTACGCTTTTGTGCGA
TATAAATTGACAAGTTGCACTAGTCGTGCTTATGATTAATGCAGTTCAAACTAACTTGAG
ATTGGAGGAAACAAGATTAAAGTGCAATTCTCTGATTATAACAAGAGGCCAGAAATTGTT
GGCGATTTGCCTGGCTATGATTGTACTTACTTAAACTGTACAACTCTCTTTGTAGCATTT
ATTGTTAACTCTCAACTGCCTTCTCAAGAAAGACTTGAAGAAGTTTTCTCTAAATATGGG
AAAATTAGAGCAATCTACATGAAATAGACGAATCCTAACACTTAGTACAGACCCCATGCA
TTTATCGACTACTATGAACATGAAGATGCAAGAAAGGCAAAGGAAGATATGGATAAAAAT
CCTCAAATTCGATTATAACTTAGCGATAGAAGCTGCGAGGTACTCTTTGCTATTAAGAAG
AGATGCAAGGATTTTAACAACCCATAGATGGGTCCTCACTCAAATTAGTATCAAACAATA
ATAAACGCAAATGTCCCCATACCACATAGCAATCCTGCTATGATAATGTCCAATATTAAT
ATCTAATAGTAGTAGCAAGCTTCTTAGGAAGCTCAGTAGTTAATTTAAACTCTACAGTAG
TCACCTGATTTCTAAAAAATTATGCAATAAAACCCTTAAGTGGCTTAGGCTTTGATTAAC
CAGATAAATTTGAATCCTGGAAATGCAAAACAAATTATTGCAGACTTTATTCAACAGCTC
AGTCAAGGAAAAGTACCAACTTTTGATTAACCTATGAACTAAATGAATCAGTATGGAGGG
TTTACAGGAATTAATCAAAATATGAGGCAAATGGCACCAAATGCCATGATGCAAGGGTAT
TAACAGTAATTCAGACAGCAGTTCAATCCATATATGGCTAGATAAATTGTACCTCAAAAC
TAAATGATGATGGGTCACCCAAATATGATGATGGGGTAATAAAACATGATGCGACCTAAC
ATGTTCCCTGCGAACTAAATGAATTCTTTTAACATGCCTCAAAACCAGTTTCGACCAAAC
GTATCAAATCCAATAATGCAAAATCCTCTATTGATGAATCAACAACAGCCTTTGGTTACT
GATTAATAGCTGATAAATCAAAATCAATCTTTACCAAGTCAGATAGGCCAAGGTGAAAAT
TCAAACTAAGCAGCACCAACAAATTAACCAGACTCAGCTCAGTAAATGATGACAAATTTG
ATAAACATGATCAAGCCAGGTTAACCACAGCAATCAAATCCAGAGCAGCAAATTTAACAA
TAGCTTCCACAGCAAACTCCCATAAATCCTTTGTTAATGAATGCTTAGAGTGTGTAATCG
CAAAACCCTACTAATCCATCATTAAATATGCAGTAAAACTAATTCTCCACTCAGATGGGT
GGTTAGTTTATGCATAATAATCCTAATTAATCTAATTTGATTCCTTCTTCCACCTGGTAG
TAGATGCCAGGTGCTTCCTAGCCCATTCCCATTAATCCTCTTCTTTCGAATCCTTTGATG
ACTCAAATGTCTAATCCAATTGGGGGAGCTGCCCCAAACTAAATGAATATGGGAATGGCA
GGACAACTTACACAACAAATGACAGCTGCAGGACAGACAGGAGGACCAGCGACAGTACCA
GAAAGCGGCGGAAAGATCAACGACATCATGGCCCTAATTAGGTAGCAAAGAGAAAAGAAG
ATAGAGCAGGAGGAACAAGAGCGACGATAACAAAACCAAAATAACAATACCACTGGAGGA
AATTCTACAGAACAATAGAATGGAGGGAATAGCAGAAAGCCAAAGTGTGTCTTGGACGAT
GATGATAAGTTTGTTTGGGCAGGATTTATAACAAGAAATAAGCAGCATAGAGTTGGAGTG
GATGCCTACTCAGTCCAAGGAGAACATAATGACACATTCTTAACTGACTATAACTTGAAT
GTTTCACACAGAACTAATTTTGAAGATATTGACAAATATAAGATACAAGGAATCGTTGCT
TTGATACCCTAAAATGAGACACAAGAGGCAGAGTTTGTTCAATATATCGATTACTTCTAG
TCAAAAGATAGAATTGGAATGGTTTATCTAAAAAATGGATTGATGTTTTTGGTCCCACCA
AGCACAGTTTCACAAAGATACTTTGATGACCCCAGAAAGCACATGCTTGGTGTTTTTATT
GATTAATAATCAGCTTAAATTCAAATTCAAAAGTTCAATCAAGCAGCTCAAGGGTACATG
AAATGA


>Contig1235.1.g124(protein)
MSKLIRSGSDISPKEQPSLAKSHSASSHKRSRSRDKTDSATSLRRSDKDQSSSQIKERDQ
ELLKDKKSEDRGRNKSRSRSPHHTSGGGGGGGNIERFPGSGQGSSTALSSKHDNSGRSAS
ENKRRDDKNQAKKSTDQESPKRKTKLYIRDLPIDTTEDYIKQELNKYAQIVEVNIRKREK
NNTVQVMVLIKGSQRDGEKIKSSLRDKKKWEISVQEVEVDRKSSRSRERDREREKQRDRE
RERDRLRDKERDRDVKDRDRKQRSRSRDHQHRNRKSTSSSEKRHKKRDQQGNSRQHHNHE
RDNSKSHSHSNNRQNGKNQNENNSNNKIPKELSEKDDSVTIVVAQGPKPRGDVRVRELWL
GNLPENISEKVVYSHFFIYGDIEKIEMNQHKSYPYYAFVRYKLTSCTSRAYDQCSSNQLE
IGGNKIKVQFSDYNKRPEIVGDLPGYDCTYLNCTTLFVAFIVNSQLPSQERLEEVFSKYG
KIRAIYMKQTNPNTQYRPHAFIDYYEHEDARKAKEDMDKNPQIRLQLSDRSCEVLFAIKK
RCKDFNNPQMGPHSNQYQTIINANVPIPHSNPAMIMSNINIQQQQQASQEAQQLIQTLQQ
SPDFQKIMQQNPQVAQALINQINLNPGNAKQIIADFIQQLSQGKVPTFDQPMNQMNQYGG
FTGINQNMRQMAPNAMMQGYQQQFRQQFNPYMARQIVPQNQMMMGHPNMMMGQQNMMRPN
MFPANQMNSFNMPQNQFRPNVSNPIMQNPLLMNQQQPLVTDQQLINQNQSLPSQIGQGEN
SNQAAPTNQPDSAQQMMTNLINMIKPGQPQQSNPEQQIQQQLPQQTPINPLLMNAQSVQS
QNPTNPSLNMQQNQFSTQMGGQFMHNNPNQSNLIPSSTWQQMPGASQPIPINPLLSNPLM
TQMSNPIGGAAPNQMNMGMAGQLTQQMTAAGQTGGPATVPESGGKINDIMALIRQQREKK
IEQEEQERRQQNQNNNTTGGNSTEQQNGGNSRKPKCVLDDDDKFVWAGFITRNKQHRVGV
DAYSVQGEHNDTFLTDYNLNVSHRTNFEDIDKYKIQGIVALIPQNETQEAEFVQYIDYFQ
SKDRIGMVYLKNGLMFLVPPSTVSQRYFDDPRKHMLGVFIDQQSAQIQIQKFNQAAQGYM
K