Identifiers and Description

Gene Model Identifier

Contig661.0.g52

Standard Name

RRM33

Aliases

Contig661_0_g52

Description

RNA recognition motif (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam04818 ) RNA polymerase II-binding domain
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004978605.997612587164444e-16RNA binding motif protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig661.0.g52(coding)
ATGAGCTACAATTAAGATAATTACTAGCAATAGTACGACTACTCAGCATACTACGCATCC
TACGGGCAGAGTGCTGAAGGTTATTAAAATCAGCAGGCAGTAGCTGGTGCAACTCACTAA
TATGGCGATCAGTAACACCAAGCTTTTTATGCATAGCAGTAGTAGCATCAACTCACTGAT
TCTCAAAACTATGCTGCTTATCAAGCGACTGCTGAATAATATCAATAATATGATCAAAGC
TATTATGGAACTCAGCAACAACAGTACGATTAGAGCTACTACTATCAAAATAATGCAAAT
TAAGCTACAGATTATCAAGGGTATATCACTTAGTAGCCTGCAATAGAATAAGCTTAACCT
GAAAATGTTCATGAAGACAGCAATACTGTATAAACATTATTTTATCGATAACTTTGCCCC
CCATAGTTAATGCTTACCAATATTCCACAAGATGTGACTCAGAAGCAAATTGAAGCTTTT
TTTAAAACTTCATGCCTTCAAATGGGATGTGCCATGTTTGAAAGTGTTAGTATGATCACT
GCTTTAAAGATGGCATATGTGGTCTTCCCATCAGTAACTTCGTCTAAAACTATATTCAAA
ATGCTGAATGGAAGCTTCAGCTTGAATGGCAAGCACAAAATTGAAGTTGCCTATTCTACA
AGCACTTTAAGGGCTGAGAGAAACGAAGCTGCAGAAAGAATTGGAGGACAGGCAGCACTT
TTTGGGCAAGGCCTCTCGTTTTATGATCCTGAGACTAAAACATACATAACAGGAAACTAA
GAAACAATATGTGATGGCAAAAACTTCTCAAGAAGAAAAGCATGCTATAAATGCTCAAAG
ACTAAAACTATCAATGCAAAAATTGTTCCAGTTGTGAAACAAAAGTAAATCTAGTAACCT
ACAGCTTTTAATGCTTCACTCTCAGCAGCTCAATTTTATAATGAAGCATCGCAATCTGGA
ACTCCTCTTCCAGCTGCATCTTAAATGCCATTATATCACTCTTATGGATAATCATCAAAC
GGATAAAATAATAACATTCAAGCTGTGAATCCACTTGCTCAAAATGTAGCGCCACAGTTG
CTTGCTGCAAACATTGAAATGCCAAACACAAGCCTAATGGTTAAAGATGTCAGACTTATT
AGAGAAAAGCAGTCAGAAGCTACTTTACAAGCACCTTTCAAAGATTTTGCATTTGTGGAA
TTTTTCTCGGTGGAGGATGCCAGCTAAACGCTTGAACAAGCAAAGTACGATAAGCTTAAA
ATTAGGGGTTCTTCTGTCTATGTTTCCTTTTCTAAGTTCAAAAGACATGAATAATATTTT
GAAAGTTTCTTTGACTAATCATAAGGAATAAAGAACTAATAAAATGAAGCCTAACTTTAA
AAGCAATTTCCAGGTTAAAGTTAAGAGTTAGGCAAGCCTTCTATTGAGAACATTTCTTTG
CCCAGAAAAGAATTTATAGAACCAGATCCAATTAACCTACAGAATAATCAACATAGAGAG
CCTTAGCAATAAACTCACTAAGACAGAGAAAAGGCTGAGAATGAATTGAAAAGGTGGGAA
AAAGAACAATAAAAGATTGAGAAATTGAATAAGCAATTGATGAGTATTGATAAGAGTCTT
CTAATTATGCCAGATAATCTAGCAGAATATGAAAACGTCCCAAAGCTTATTGAGAACAAA
TCTTAAGAAATTGAAGAACAAAAGAAAATCAAAAAGGAGCAGGCATCGAAAGTACCAGCT
CCAACATAGTATGAAGTTCATATTTGTAATCCTTGCAAAAGATTATTCAGAACATTAAAC
ACCTTACTCAAACATTAGTAGGATTCTTTATTACACATTAAAGTGAGTTATGAAATGTCG
CAGAAAAGAGCAAGAGATGAAAATAGGCAGAGAGTTTAGGAAAGTCTAAGAAAAGAAAGT
TTAGTAGATTAGCAAACAGCACACACTTCATCTTAAGACAAATTGACCCTTCATGATTAA
AGTGAAGATGCAAAGTTAGCTGGAAATAAAAGGAGAGACCGCGACGAACACGATCATAGA
GATAGAGATTATCATCAATTCAGAAATGAAAGAGATCATCATGATAAGGAGAGAAGAGAA
AGCTTTAGTCATAAGGATTTGAGAAGTGATAGTCATCACCATCATGGAAGCGACGGCAGA
AGCAAACAGCACAGATAGAGTTTTGATCATAGAAACGAAGATACCTTAAAAAGACGTAGA
TCATCGAGATCATCTTCCAACTATAGAAAAAAGAGCATCTAGGAGATTCTCGAACGTAAC
AGAAATGTATCAACTCAAGTCGTGGGTACCATCAACCAGCATTACATACAAGATCCAGCA
GACAAAAAGCTGCTCTACTTCTTTGTGGCTAATGAAACCATGCTCAAGACTAAAGATAAA
GGAATTGAGTATGTGAAAGCTTTTGGGGATATCTTGTAAAGCTGGGTTGAGAACTTTATG
AGCTGTGTTGAAGATCTGAATTAAATAGATCAACTCTTGAGATTGCTTGATATATGGGAT
TAGGAACATATCTTTTCTAAGAGCTTTAGTGATTTATTGAGACAGTTCATCAAGCCTAAG
TATGATATTGGGATGCAAAAGATGAACTAATAGGCAGGAATTGGTATTGGAGTCATGGGT
TACGAAGCTATTCAACTCAATTAAGCAAAGCTAGCCAAGCAACTCAAAGCTATTAATTCT
TACTCTGAGACTATCCAAGCTGTAAAGGTTGACCTTATGACACACAAGCTAGATGTGAAC
CAGAGATTACAGCATTTGACTTCCTACATCTCTAACATCGAGAGAAAGAAGCCTGAAGAA
CTTGGCCCTAATGACTTGAAGAGCATTGAGAACATTGAGAAAGACTTGCAAGAGTTGAGG
AAGTAGCAGATGGAGCTTGTTGAGTAAAATATAAAGTCTATGTTTGAGATCAGCACCATG
GTGGCAAGAGAGAAGGAACACTGGATTGAGCTTGAATAATAAAATAAAGTGGCAAAGTAT
CAGGAAGCTCTCAAGAAAAAGCAATCAAAGTTATAAGCCTGA


>Contig661.0.g52(protein)
MSYNQDNYQQQYDYSAYYASYGQSAEGYQNQQAVAGATHQYGDQQHQAFYAQQQQHQLTD
SQNYAAYQATAEQYQQYDQSYYGTQQQQYDQSYYYQNNANQATDYQGYITQQPAIEQAQP
ENVHEDSNTVQTLFYRQLCPPQLMLTNIPQDVTQKQIEAFFKTSCLQMGCAMFESVSMIT
ALKMAYVVFPSVTSSKTIFKMLNGSFSLNGKHKIEVAYSTSTLRAERNEAAERIGGQAAL
FGQGLSFYDPETKTYITGNQETICDGKNFSRRKACYKCSKTKTINAKIVPVVKQKQIQQP
TAFNASLSAAQFYNEASQSGTPLPAASQMPLYHSYGQSSNGQNNNIQAVNPLAQNVAPQL
LAANIEMPNTSLMVKDVRLIREKQSEATLQAPFKDFAFVEFFSVEDASQTLEQAKYDKLK
IRGSSVYVSFSKFKRHEQYFESFFDQSQGIKNQQNEAQLQKQFPGQSQELGKPSIENISL
PRKEFIEPDPINLQNNQHREPQQQTHQDREKAENELKRWEKEQQKIEKLNKQLMSIDKSL
LIMPDNLAEYENVPKLIENKSQEIEEQKKIKKEQASKVPAPTQYEVHICNPCKRLFRTLN
TLLKHQQDSLLHIKVSYEMSQKRARDENRQRVQESLRKESLVDQQTAHTSSQDKLTLHDQ
SEDAKLAGNKRRDRDEHDHRDRDYHQFRNERDHHDKERRESFSHKDLRSDSHHHHGSDGR
SKQHRQSFDHRNEDTLKRRRSSRSSSNYRKKSIQEILERNRNVSTQVVGTINQHYIQDPA
DKKLLYFFVANETMLKTKDKGIEYVKAFGDILQSWVENFMSCVEDLNQIDQLLRLLDIWD
QEHIFSKSFSDLLRQFIKPKYDIGMQKMNQQAGIGIGVMGYEAIQLNQAKLAKQLKAINS
YSETIQAVKVDLMTHKLDVNQRLQHLTSYISNIERKKPEELGPNDLKSIENIEKDLQELR
KQQMELVEQNIKSMFEISTMVAREKEHWIELEQQNKVAKYQEALKKKQSKLQA