Identifiers and Description

Gene Model Identifier

Contig3470.0.g101

Standard Name

RRM31b

Aliases

Contig3470_0_g101

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08719 ) Domain of unknown function (DUF1768)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00498 ) FHA domain
  • ( pfam13075 ) Protein of unknown function (DUF3939)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004907509.996162112727537e-67FHA domain containing protein
SGDYNL175C0.00000019998969434520019NOP13 SGDID:S000005119, Chr XI
V from 308612-307401, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3470.0.g101(coding)
ATGTACTAGCCAATTCACGGAGGAGCCGCCTCAACCTCATCAGCCGCCTATTTCATGTAA
TAAGAGTCTCATAAACCCCATCATAACCCCTATTAGGACCCCAGAAATGCAAAATACGAA
AAATATGGTGATTAGTAGGAACTAGAAGCAGAGATAGAACGCGATGCCAAGTTACTCTTT
AAGAAGAAACAATTGGATAAGATCGAAGGATTCAGTGGGTATTTCGAGTTTATGAGGCCA
GATTTTCCTGCCCAAGTTTACTATGAGGGAGAAATGTATTCTACAGCCGCACATGCTTAT
AATGCAGCCAAAATTCCTGATAAATAATTGAGGAGAAGGATTCAGAAAGCGCCTACACTC
TAAGAGATGTACAATGTCGCTCGAACAATCGTTGAACCAGAGGGTTGGTCAAATAAAAAA
CTTAAAATAATGGAGAAAATATAGAGAGATAAATTTAGACGCAGCAGAGACTTAAGAGAG
CGATTGGCTGCCACTCAAAACAGAGAAATCATAAACCACTTGACAGATAAGAACGATGAA
AACTTGTTTTGGGGTATGGTCAACAAGCAAGGCCAAAACAACCTAGGTAAGATTCTGGAG
AGAGTGAGATAGAGCGTCTACGATGAAAGTGAAATGGAGTAATGGATGCAAAATAACTTC
AATTTAGTGGAGGGTAGGAAGCGCATCCCCACTATAAACTTGGAAGTGTTCAAGGATGGC
TAACTGATTGAAAGTATCACACTTGAGAACAAACCTTACTACATCTTTGGTGCTCATCCT
CAGAAATGTGACGTTGTACTAAAGCATCCATCTATTTCCAGAGTTCACTCTGCATTCCTG
ATTGATGAGGATCTAGGAGTAGTGATTATGGATCTAATGTCAAAAGCAGGCACTAAACTC
GACGATCAAATTCTTGAAGGTTGTGTCCCCTAACAAGTCAAAGCAAAAGCAGACTAAAAA
GTGGTGTTTGGACTATCTACTAGAGTGTATCAGATTTCCATAGATTACTCTAAAATGCAG
AGAGCAGTGGAAAACGAAAAAAGAAACTTGGAGAGAGAAATGCGATTACTAGAGAAACTT
GATGATGTTGATAATATGGATGTGGATACTTTGAAGTAAACACTAGGATTGATCAAGCAA
GATACTATCTATGTGTCAAACTTGCCATTCAGCGTTACAGACAAAGACCTTCAAGATTTA
TTTGGAGACTGCGGTAAAATCCTCTCAATCCGCATGCCATTAAACAACCAGACCAAGCAA
GGCAGAGGTTTCGCGTTTATCACGATGGCTGATGAGAAAGCAGCCAGAAGAGCATTGAAC
TACGATGGCCATAAATTCTATGACCGCAGGTTGAGAGTGAGTCAGGCTGAAAAGAAAGCA
GAGATTGAAGATCAGAGGAATAGAGACCAGAAGCAACAGCAAACTGGAGAACGAAGAGAA
GGTGGTAGCAAAGTTGAGAGCAATAATGACAAGGAGGAAGTCAAGAGAGGTGGAAGAGAT
AATCTTAATAACAGAGATGATAAATCATATCGTAATGAACGAAGAAGAAGCCGAAGCAGA
GAAGATAGAGACAGGAGATATAGAGATGACAGAAGAGACCCCAGAGATAGAAGAAGAGAC
TCCAGAGACAGATACCAAGATGATAGAAGAAATCCAAGAGATATCTAAGAATACTCAGGA
AAGCACAGAAGAGACGATAGAAAAGACACTGAAAAACCTTAACAAAAGTCTAGAAAGCAG
AAATCCCCTTCAAAACCATCACACTCTGAGAGAAGCAGATCACAGTCAAGTTCATCGGTT
ACTTCTAAATCATCACAATCTTCTCAGAAATCCAGTGATTTCGAGGATAATCCTTTGGTA
TTGGATGAGCAAACCAAGAAAGAGTGA


>Contig3470.0.g101(protein)
MYQPIHGGAASTSSAAYFMQQESHKPHHNPYQDPRNAKYEKYGDQQELEAEIERDAKLLF
KKKQLDKIEGFSGYFEFMRPDFPAQVYYEGEMYSTAAHAYNAAKIPDKQLRRRIQKAPTL
QEMYNVARTIVEPEGWSNKKLKIMEKIQRDKFRRSRDLRERLAATQNREIINHLTDKNDE
NLFWGMVNKQGQNNLGKILERVRQSVYDESEMEQWMQNNFNLVEGRKRIPTINLEVFKDG
QLIESITLENKPYYIFGAHPQKCDVVLKHPSISRVHSAFLIDEDLGVVIMDLMSKAGTKL
DDQILEGCVPQQVKAKADQKVVFGLSTRVYQISIDYSKMQRAVENEKRNLEREMRLLEKL
DDVDNMDVDTLKQTLGLIKQDTIYVSNLPFSVTDKDLQDLFGDCGKILSIRMPLNNQTKQ
GRGFAFITMADEKAARRALNYDGHKFYDRRLRVSQAEKKAEIEDQRNRDQKQQQTGERRE
GGSKVESNNDKEEVKRGGRDNLNNRDDKSYRNERRRSRSREDRDRRYRDDRRDPRDRRRD
SRDRYQDDRRNPRDIQEYSGKHRRDDRKDTEKPQQKSRKQKSPSKPSHSERSRSQSSSSV
TSKSSQSSQKSSDFEDNPLVLDEQTKKE