Identifiers and Description

Gene Model Identifier

Contig17854.0.g17

Standard Name

RRM2a

Aliases

Contig17854_0_g17

Description

Bacterial protein of unknown function (DUF910)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam06014 ) Bacterial protein of unknown function (DUF910)
  • ( pfam06600 ) Protein of unknown function (DUF1140)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17854.0.g17(coding)
ATGATAAATGTTTGGGCCTCAAACGAGAAGCGAGAAGAAGTAATAAAAAGAAAACTATTG
ACTGATAAATCATTCAAGTTAACTTCCCTCCAAGTCAATCCACTCTACAAGCCCATTTTT
GACAAGCTAGATGCCATAGCAGTCAAATAACTTAATTAGCTTGATAAGAGTGTTCTCTGG
TCTCGCCATTACACAAAATAAGAATTCAAGTTCACATTCGCATATCCCTTGGCTGTCTTT
GCAGTGATAATATTCTGTTCTATTAGTTATGGCGTCAAGTACAGATTATATGCAAATTAT
ATAAGATATGGAAGGGAATTAGAGTTGGCTGATATGATGGACATTGATCTAGATGACATA
AGTTAGTACCCTAAGGCAGTTCTAGAATTATACAAAGAAAAGAAGAAGCACGATGCATAT
ACAAAATAGAAGGAAAGTAAGATAAAAACAATCGAGCAAAATTTTCATAAATTCGTCGAG
AAGCGAATCGTAGATACTGCAGAATATAGGAAAAAGAGGGGACTTAGAGTCATTTCAAGA
GAAAATTCTATATCTAGCAATACTCAGCCTGGATCTCTATGA


>Contig17854.0.g17(protein)
MINVWASNEKREEVIKRKLLTDKSFKLTSLQVNPLYKPIFDKLDAIAVKQLNQLDKSVLW
SRHYTKQEFKFTFAYPLAVFAVIIFCSISYGVKYRLYANYIRYGRELELADMMDIDLDDI
SQYPKAVLELYKEKKKHDAYTKQKESKIKTIEQNFHKFVEKRIVDTAEYRKKRGLRVISR
ENSISSNTQPGSL