Identifiers and Description

Gene Model Identifier

Contig964.1.g31

Standard Name

RRM1b

Aliases

Contig964_1_g31

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00658 ) Poly-adenylate binding protein, unique domain
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08675 ) RNA binding domain
  • ( pfam11148 ) Protein of unknown function (DUF2922)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER165W1.9994920269952867e-34PAB1 SGDID:S000000967, Chr V f
rom 510373-512106, Genome...
T. thermophilaTTHERM_002484300.00000030014504373857585hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig964.1.g31(coding)
ATGAACACCGACATTAAAAACATTCTTTACTTGTATGACCTCCCCAAGGACAACATCACC
TCAGTCAACATTGCTTAAACTATCAAGGACCGCACCAAGTACGAAATCATTGATCAACCA
CAAATCAAGAGAGACGCAAGCAAGCCATTCTATACCGCCATGGTTAGAATCAATGACAAT
GACAAGTTCAAGGATGTCGCTCGTGACATGAAGTACTTTGAAATCAACGGTAAACAATGC
AGAGCCCTCCCTTACCTCAAGGAGGTCACCGCCGCCCATAGAAACAACATGAACAAGGCA
AACAATTTGTTCATCAAGAATCTCGATAAGAGCATCACCTCTCAACAACTCGACGAATCT
TTCTCCAAAGTTCTTGGTAGCGACGTAGTTGTCTCAGCCAAGGTCTCAATCAACGCTGAT
TACACATCCAGAGGATATGGCTTTGTTTGCCTTTCCTCTCCAGAGCTAGCCGAGCAAGCT
CTCGCTACCAGTGATTCGTTCAAGTTCGATGTCCACCCATTTAATCCAAAGGACAGAAGA
GAACTCAGAAAGACCTTCAACAACATCTATATCAAGAATTTCCCCAGTATCTGGAATCAG
GAAAAGATTGAGCAAATCTTTGGCTAATATGGTACCATCAAGAGCACTTTTATCAAGATG
GGGAAGGTCCAAGGTACCGACTAAGAGGCTCCATTCGCCTTCGTTTGCTACGAAGACCCA
GATAACAAAGAATACGGTCCAAGATGCGCTTTGAACGCTGTCACACAAGAGAACGAAAAA
GAGTACGATGGTATCAAGCTCTACGTTAAAGAAGCTCTTCCAAAGAAAGAGAGAGAGCAA
GAGAAGAAGAGAGAGCAAAACAGATTCAAGAACTCCAAGAAGAGATGCAATCTATACGTC
AAGAACTTCCCAGAGAACACCACTGAGGAGCAACTCAAGGCCTACTTTGAAAAGTACGGT
GAAATCGAAAGCATTAAGCTTAACCTTAAAGAAGGTGCTGCCGTCTATGCCTTCGTCTGC
TACAAGAATCCAGAAAGTGCTACCTATGCCAAGCAACAAAGTCAAACTCAAACCTTGAAT
GGAAAGCAACTCTTCTTGAACTTCTACGAGCAAAAGGAAGTCAGAAAGATCCAACAGGAA
GACGCTAGAGATAGAACCGATTTCCAAAATCATAGAAAACAATCACCAGGCACTGCTCTC
AACATTGATATGTTGAACAGACCAGAAACCTTCCAACTCCTCCAGTACTTAATGATCACC
ATCCAGAGACAACAACAAAACCAAAGATACAACAACAATCCCCAAAGATAAGGTGGAAAC
ATGCAACAAAGAGGTCCCAGACAACAGTACAACAACCAAGGTGGTTATCAACAAAGAAAC
CAACAACTCCCACAAGGACAAATGCCACCCCAAATGAACCAACCAATGAGACAACAACCA
CAACAGCCACCTCAAGGCATGCCACTTGCCCAAGTTGCTCCAAGCGCCATGAGCTAAAAC
ATCCCACCTCAAATCCTCGCCTACAACCAAAATGGTATGGCTAAGATCCTCCCACTTGTC
AGCGCCCTCAACCCCAACTATAAATCTCAAGTTGGTGAGTACATCTATGAGCATGTTGAY
NNANTNGCTGGTGAAGANRTTGCTCCAAAGATCACTGGTATGCTTATCGACTTGCCAATT
CCAGAAATTCAAGCCTACGTCAAAGACTTCATGAAGCTCCAAATCAAGATCAACGAGGCC
TCCACTCTACTTAAGAAGTGGAACTACAATATCCATAGTGATTATCAATAAGAAAACTAA
CAAGTTGATCCTAGACCAAATAACCACTCACCTCTCTCTTACAACCAAACTGGTATGACT
AAGATTCTCCCACTTGTCAACGCCTCAAACCCCAACTACAAATCTCAAGTTGGTGAGTAC
ATAATGGAGCATATTGTGCAATTGGTAGGTGTAGAACTTGCTCCAAAGATTAAAGGTATG
CTTGTCGACTTGCCAATTCAAGATATCCAAGCCTACGTTGTAGACTTCAAGAAGCTCTTA
ATTAATATCAATGAGGCCTCCACTTAAATTAAAAGCTCACAATATGAATAAGAATAAGAT
TTCTGA


>Contig964.1.g31(protein)
MNTDIKNILYLYDLPKDNITSVNIAQTIKDRTKYEIIDQPQIKRDASKPFYTAMVRINDN
DKFKDVARDMKYFEINGKQCRALPYLKEVTAAHRNNMNKANNLFIKNLDKSITSQQLDES
FSKVLGSDVVVSAKVSINADYTSRGYGFVCLSSPELAEQALATSDSFKFDVHPFNPKDRR
ELRKTFNNIYIKNFPSIWNQEKIEQIFGQYGTIKSTFIKMGKVQGTDQEAPFAFVCYEDP
DNKEYGPRCALNAVTQENEKEYDGIKLYVKEALPKKEREQEKKREQNRFKNSKKRCNLYV
KNFPENTTEEQLKAYFEKYGEIESIKLNLKEGAAVYAFVCYKNPESATYAKQQSQTQTLN
GKQLFLNFYEQKEVRKIQQEDARDRTDFQNHRKQSPGTALNIDMLNRPETFQLLQYLMIT
IQRQQQNQRYNNNPQRQGGNMQQRGPRQQYNNQGGYQQRNQQLPQGQMPPQMNQPMRQQP
QQPPQGMPLAQVAPSAMSQNIPPQILAYNQNGMAKILPLVSALNPNYKSQVGEYIYEHVX
XXAGEXXAPKITGMLIDLPIPEIQAYVKDFMKLQIKINEASTLLKKWNYNIHSDYQQENQ
QVDPRPNNHSPLSYNQTGMTKILPLVNASNPNYKSQVGEYIMEHIVQLVGVELAPKIKGM
LVDLPIQDIQAYVVDFKKLLININEASTQIKSSQYEQEQDF