Identifiers and Description

Gene Model Identifier

Contig16564.0.g25

Standard Name

RRM14a

Aliases

Contig16564_0_g25

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00098 ) Zinc knuckle
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13917 ) Zinc knuckle

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002192500.0000000000010000211161514907hypothetical protein
SGDYDR432W0.000000030002053728821195NPL3 SGDID:S000002840, Chr IV
from 1328783-1330027, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16564.0.g25(coding)
ATGAGTCTATTCGTTGGAAATATCGCAAGAAACGTGAGATAAGAAGACCTACACGAGGAA
TTCGACAAGATTGGCCCCTGCACTATCAACTTCAAGGGATCATTCGCTTTCATCGAGTAC
AAGGAAGAGCGTGATGGTGAGGAAGCTATCAACGAGTTGAACAACAAGGACTTCGGAGGC
CAGAAAATTGGCATCGAGTGGTCCAAGAGATCAGGAAAGTTTGACTCCAAATCAGGCGGC
AACAGCAGAGGTAGATCAAGAAGAGATGACTCTAGAGACAGAGGCAGAGACGGTGACAGA
AGAGTAGGTACTGGCAACAAAGATTGCTATAACTGTGGTAAACCAGGTCACTTCGCTCGT
GACTGCAGAGCCCCAAGAAGAAACAGATCTAGAAGCAGATCTGGCGGCAGAGGCGGAAGA
GGCGGCTTCAGAGGCGGTGACAGAAGAGATAACTACAGAAGAAGAGACGACTCCAGAGAC
AGAAGAAGACACGACTCTAGAGATAGAAGAAGAGACGACTCAAGAGACAGAAGAGGCGGT
GGCAGAGATAGAGATGATTCTAGAGATAGAAACAGAAGAAGATCTAGCTCACCCAGAAGA
AGATCCCCTGTTGAGAGAAGAAGCAACTCTCCAAGAGTTTCACCAAGAAGATCTCCAAAG
GATGTCGGTAACGGTGATGTCAGAAGAAACGAAAGCCCAGAGAGAGATTGA


>Contig16564.0.g25(protein)
MSLFVGNIARNVRQEDLHEEFDKIGPCTINFKGSFAFIEYKEERDGEEAINELNNKDFGG
QKIGIEWSKRSGKFDSKSGGNSRGRSRRDDSRDRGRDGDRRVGTGNKDCYNCGKPGHFAR
DCRAPRRNRSRSRSGGRGGRGGFRGGDRRDNYRRRDDSRDRRRHDSRDRRRDDSRDRRGG
GRDRDDSRDRNRRRSSSPRRRSPVERRSNSPRVSPRRSPKDVGNGDVRRNESPERD