Identifiers and Description

Gene Model Identifier

Contig20005.0.g62

Standard Name

RRF1

Aliases

Contig20005_0_g62

Description

Ribosome recycling factor

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01765 ) Ribosome recycling factor
  • ( pfam02844 ) Phosphoribosylglycinamide synthetase, N domain
  • ( pfam13892 ) DNA-binding domain
  • ( pfam04277 ) Oxaloacetate decarboxylase, gamma chain
  • ( pfam13767 ) Domain of unknown function (DUF4168)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007665001.000361553249356e-16ribosome recycling factor fami
ly protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20005.0.g62(coding)
ATGATGGGTCTTAGAAAACTTCTAGCACAATAAGCAAGAAATTAAGCTTTATCGCAGTCT
CTCTAATCTTAAACTTCAAATAGAGGCATATTTACTGTTTTAACAATGAGATCTTTCGCT
GCAAAAAACGATAAAAACAAGAAAGAAGACAAAAAATAGAAGGAAAAGGAGCAGGTTCAC
TAACAGTTCGAGGGGCAAGACCTAGATACTGTAAAGAGAGATTTTGAAGCTTAATTAGTG
GAAGCAATAAGTGCATCTGTTGAAGAGTTAAAGCTTGTTAAGTCTGGCAGAGCAGCTCCA
GATATCTTTGATCACATTGAGGTTATTGCCTATGGGGAGAAGCATCCATTTAGCGACTTA
TGTTAAACCATTGTGAAGGGTAACAACAATTTATTAGTCAGAATTTTCGATGAAAATGTC
AAGGAAGATGTGTTGAAGGCACTTGCAAGATCTGATTTTGATATTCAATGCACAGTCGAG
GGTAAAGACATAAAGGTCAAACTTGGTACTTCAAAGAAAGAACACCTAGATGCTGCACTA
AAGCAGATTAAAGTCATTAACGAAGACTTTAAACTTGCAGTTAAGGAAGTCCGACATGAA
ATGAACGAGACAGTAAAAAAACTCTAGAAAATCTTACCTCAAGAAGAAATTAAAGTTCTT
CAAAAGGACCTAGATAAAATTATTGCAAACAAAGAAGGCGATGCTAAAAAGCATTTTGAT
GCCAAAGATAAGGAAATTAAAGCTGCATGA


>Contig20005.0.g62(protein)
MMGLRKLLAQQARNQALSQSLQSQTSNRGIFTVLTMRSFAAKNDKNKKEDKKQKEKEQVH
QQFEGQDLDTVKRDFEAQLVEAISASVEELKLVKSGRAAPDIFDHIEVIAYGEKHPFSDL
CQTIVKGNNNLLVRIFDENVKEDVLKALARSDFDIQCTVEGKDIKVKLGTSKKEHLDAAL
KQIKVINEDFKLAVKEVRHEMNETVKKLQKILPQEEIKVLQKDLDKIIANKEGDAKKHFD
AKDKEIKAA