Identifiers and Description

Gene Model Identifier

Contig12261.0.g103

Standard Name

RPUSD4

Aliases

Contig12261_0_g103

Description

RNA pseudouridylate synthase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004021400.00000000019994075865167896RNA pseudouridylate synthase f
amily protein
SGDYGR169C0.000009002574193719714PUS6 SGDID:S000003401, Chr VII
from 835903-834689, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12261.0.g103(coding)
ATGTATCACTTGACCCTTACATGGATTGCAGCTCAGAAATTTATCAGGTCAAAGTAGGTT
TATATTGTTAGAGAGATTGATTAAGACTCTATTGCAAAGGATGAAGATGAGATTAAAGAT
AGTATTAATGCTGATGATATAATTGGAGACAAAAACCCAGAAAATAAAAAAATCTATGAA
ATAATATGCAGAGATGCAAATTACAAATTGAGAGAGGATGATATGCTTTGCCTCCCCAAG
GCTTTGGTCAAAGATTAGCAATTGCTTTTGCAACCAGAGGTGAAAGATAAAAAGTAAGAA
TAAATTGCAATTAATAAGTTGAAATAAATGATCATCTTTGAAAATGAGCATATAATAGTC
ATTAACAAAGATCACGGGGTGCCTTCATAAATGGGTTCTGGACTTGAATCTGATAAAAAC
TCTGATATATCTGTTGACACAATGCTTTCATATTACTGTCCTTCCAATGAAGATGGAAGC
ATAGGTGGAAGGCTAGTTCATAGATTAGATTAAAAAACTGGGGGATTAATGGTACTAGCA
AAAACTAAACTAATGGCAAGGTATTTAGGTGAATGTTTTAGAAATAGAGACTTGTATAAA
GCATATTATGGACTAGTATGTGGTGTTCCCAAATACCAAAGTGGTCTTGTTTACCAATCC
TATGATTAAAACGAGCATGGGTGGCAAATAGACTTGCAGTCCTCTTAAAACAGTTAAGTA
ATTAAACATCCAATCTTTGATACTCTCGGTTTAACTCAAGACCAATTAGACATGAAAACT
AAATTTGAGGTTTTAACTGTTGTACAATAGTAAACTCAATCTCAAATTTCAAAAGAGTAG
TTTGACAATAGCCTTTAAGAGAAAGTATCATAAATTAGATAGAAAGAAAATTTGAAGGAG
AGTGGTGCCCCAAAATTAGGTAATTGGTATCCATATAGTTCTGAATAAGTTTATGATCTT
GAGACTTTATAGTTTAAAAGCAGAGATCAAAGAGTTATTGACTCTAGAAATGAGTCTTAT
TCATACGTAAAATTTCAAATTTATTCAGGTAAGAAGCATTAAATTAGGCTCTTATGCGAT
AATGTTTTAAATTCTCCACTACTCTTTGACACCAAATACGGCTATGATCCAAATGTCTAT
TCTAAAAATTTGTTCTCAAACAATACTAAGAGTGGATCTAATCAAGGGGTTTTGGGGTTG
AGTAACAACCAAATCAATGATAGTAAAATGATTATGCTTCATGCTGGTGAACTTAAAATA
CCTATAGAACCTCCGAAAAATTATTCTTCAAATGTTCCTGCCAGTGAGCTTGAAGTAGCT
AAAGAATAGCTATTTATAGGAAAAATGAAGCCTTAAATGGAGAAAATTTGCGATTTCTTA
CATATCAATAAACTTTACTATTGA


>Contig12261.0.g103(protein)
MYHLTLTWIAAQKFIRSKQVYIVREIDQDSIAKDEDEIKDSINADDIIGDKNPENKKIYE
IICRDANYKLREDDMLCLPKALVKDQQLLLQPEVKDKKQEQIAINKLKQMIIFENEHIIV
INKDHGVPSQMGSGLESDKNSDISVDTMLSYYCPSNEDGSIGGRLVHRLDQKTGGLMVLA
KTKLMARYLGECFRNRDLYKAYYGLVCGVPKYQSGLVYQSYDQNEHGWQIDLQSSQNSQV
IKHPIFDTLGLTQDQLDMKTKFEVLTVVQQQTQSQISKEQFDNSLQEKVSQIRQKENLKE
SGAPKLGNWYPYSSEQVYDLETLQFKSRDQRVIDSRNESYSYVKFQIYSGKKHQIRLLCD
NVLNSPLLFDTKYGYDPNVYSKNLFSNNTKSGSNQGVLGLSNNQINDSKMIMLHAGELKI
PIEPPKNYSSNVPASELEVAKEQLFIGKMKPQMEKICDFLHINKLYY