Identifiers and Description

Gene Model Identifier

Contig3407.0.1.g49

Standard Name

RPT6b

Aliases

Contig3407_0_1_g49

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005510909.997093137033517e-26226S proteasome subunit P45 fam
ily protein
SGDYGL048C9.997093137033517e-262RPT6 SGDID:S000003016, Chr VII
from 411286-410069, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3407.0.1.g49(coding)
ATGTCTTTGATACTTGAAAGAACTCAATCACTGGTGAGTCAAGAACCATCTCAAGGTCTT
GAATCTTACTATAAGAAGAAAGTAGAGGAACTGGAATTGAAAATCTTAGAGAAGAAGTCT
AATTTGAGAAGATTAGAAGCTCAGAGAAATGAAATGAACAATTTGGTTAAGAATCTCAAG
GAAGAATTGTACTTACTTTTGCAGCCAGCTTCTCAAATTGGTGAAGTTACTAAGATGATG
GGCAAGAAGAAGTGCTTAGTTAAGATCGGTGGTGAGGGCAAGTACGTTGTTGATGTGGAC
AGAAAGATCAATGTGGACTTACTGACTCCAAACACAAGAGTGGCATTGAAATCTGACTCC
TACCTTCTCCACAAAATCCTCCCATCTAAGACCGATCCACTCGTCAACCTCATGAAGGTC
GAGAAGGTCCCAGACTCCACCTATGACATGGTTGGAGGTCTCGACCAACAAATCAAGGAA
GTCAAGGAGGTCATTGAATTGCCAATTAAGCATCCTGAAATATTTGAAAGTTTAGGTATT
TCACAACCTAAGGGAGTCTTGCTCTATGGTCCACCAGGTACTGGTAAAACTCTTTTGGCA
AGAGCAGTCGCTCATCACACTGACTGTACTTTCATTAGAGTTAGTGGTAGTGAACTTGTG
CAGAAGTATATCGGTGAAGGTGCTCGTATGGTGAGAGAATTGTTCGTGATGGCTCGTGCC
CACGCTCCTTCCATCATTTTCATGGATGAAATCGATTCCATCGGAGGATAGAGAATCGAG
GGTTCCAGAGGTGACTCTGAAGTGCAGAGAACTATGCTTGAGTTGCTCAATCAGTTAGAT
GGTTTCGAAGCCACCAACAAGATCAAAATCATCATGGCCACCAACAGAATTGATATCTTG
GATGATGCACTCTTAAGACCAGGTAGAATCGATAGAAAGATTGAGTTCCCCAATCCAAAC
GAAGACGCTCGTCTTGATATCTTGAAGATCCACTCCCGTAAGATGAATTTGATGCGTGGA
ATTGACTTGAACAAGATCTCCAAGCTTATGCCTGGTGCTAGTGGTGCCGAAAGCAAAGCT
GTCTGCACCGAAGCTGGTATGTACGCACTCAGAGAACGCAGAATCCACGTCACACAAGAG
GACTTTGAATTAGCTGTTGCCAAGGTCATGAGAAAAGATATCGACAAGGACCTCGCTCTT
AAGCTCAGAAAGTGA


>Contig3407.0.1.g49(protein)
MSLILERTQSLVSQEPSQGLESYYKKKVEELELKILEKKSNLRRLEAQRNEMNNLVKNLK
EELYLLLQPASQIGEVTKMMGKKKCLVKIGGEGKYVVDVDRKINVDLLTPNTRVALKSDS
YLLHKILPSKTDPLVNLMKVEKVPDSTYDMVGGLDQQIKEVKEVIELPIKHPEIFESLGI
SQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGARMVRELFVMARA
HAPSIIFMDEIDSIGGQRIEGSRGDSEVQRTMLELLNQLDGFEATNKIKIIMATNRIDIL
DDALLRPGRIDRKIEFPNPNEDARLDILKIHSRKMNLMRGIDLNKISKLMPGASGAESKA
VCTEAGMYALRERRIHVTQEDFELAVAKVMRKDIDKDLALKLRK