Identifiers and Description

Gene Model Identifier

Contig845.1.g5

Standard Name

RPSAP58

Aliases

Contig845_1_g5

Description

Ribosomal protein S2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYGR214W1.0004671766404936e-76RPS0A SGDID:S000003446, Chr VI
I from 920575-920664,9211...
T. thermophilaTTHERM_005226306.9991332754409754e-68ribosomal protein S2 containin
g protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig845.1.g5(coding)
ATGAGCGCACAAAACTTTGCCTACTCAAAGACCAGAGAACAAGATCTTGCTCTTATGCTC
ACCGCTGGTGCCCACATCGGAACTGAAAACTGCTCCAGCTTGATGGCTCCATACATGTAC
AAACGTAACAATGAGGGAATTCACATTATCAACATTGCCAAGACCTGGGAAAAGCTCATG
ATTGCTGCCAGAATCATCGCTGCCATCCCCAACCCAAGAGACATCCTCATCGTCTCAAAC
AGAGAGTACGCTCAAAGAGCCGTCCTTAAGTTCGCAACCTACACCAAGGGTAACTATCTC
GGTGGAAAGTGGACCCCAGGTACCCTTACCAATTAAAACACCAAGAAGTTCTTAGAGCCA
AGACTTGTCATTGTCTGCGACCCAAGAACCGACCACCAATGCCTGATCGAATCATCTTAC
ATGAATATCCCAACCATCTCTCTCTGTGATGCCGACTCACCATTGAACTTCGTCGATATT
GCCATCCCATCCAACAACAAGGGTAGACAATCAATCGCCCTTATGTTCTACTTACTCTGC
AGAGAAGTTCTCTACCTTAGAGGTGAGATCGATAGAAGCGAGGATTGGGAAGTCATGGTT
GACTTGTTCATGCACAGAGACTTCGAAGACAAGAAGGAGAAGACCGTCGAGGGAGACGTC
CAAGAGGAAGAAGACCAAGAGGCTGCTGACAACGATGCTGCCGTCACTGATACCATGAAG
AAATTCTAAGACGGTGGAGATGACCAAGAAGGTGACGAGGAAGAAGACGAGGAAAAGTGG
ACAAACCCAGCTGAGACTAAGGGCGCATACGCTAAATGA


>Contig845.1.g5(protein)
MSAQNFAYSKTREQDLALMLTAGAHIGTENCSSLMAPYMYKRNNEGIHIINIAKTWEKLM
IAARIIAAIPNPRDILIVSNREYAQRAVLKFATYTKGNYLGGKWTPGTLTNQNTKKFLEP
RLVIVCDPRTDHQCLIESSYMNIPTISLCDADSPLNFVDIAIPSNNKGRQSIALMFYLLC
REVLYLRGEIDRSEDWEVMVDLFMHRDFEDKKEKTVEGDVQEEEDQEAADNDAAVTDTMK
KFQDGGDDQEGDEEEDEEKWTNPAETKGAYAK