Identifiers and Description

Gene Model Identifier

Contig18343.0.g85

Standard Name

RPS9

Aliases

Contig18343_0_g85

Description

Ribosomal protein S4/S9 N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004340705.000624069301489e-83ribosomal protein S4 containin
g protein
SGDYBR189W1.999469658314961e-75RPS9B SGDID:S000000393, Chr II
from 604508-604514,60492...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18343.0.g85(coding)
ATGCCAAAGAAGTACACTAACTACAGCAAGACTGCTAAATCACCCAAGAGACCATTTGAA
AAGGAGAGACTCACCAACGAATTGAAAGTCATTGGTGCTTATGGCTTGAAGAACAAGAGA
GAGGTGTGGAGAGTCCAATTTACTCTTGCAAAAATCAGAAAGGCTGCTAGAGATTTACTA
ACCTTAGATGAGAAAGATCCTAGAAGAGTTTTCGAAGGTGATGCTCTTATCAGAAGAATG
GTCAGACTCGGAGTGCTCAAGGAAAACGAAAGAAAGCTCGATTATGTCTTGGGTCTTACC
CTTTCACAAATCATGGAGAGAAGACTCCAAACCCTCGTCGCCAAGAGAAAGCTCGCTAAC
TCCGTCCATCACGCTAGAGTTCTCATCAGACAAAGACATGTTGCTGTTGGAAAACAACTC
GTTAACATCCCAAGTTACTTGGTAAGAGTGAGCTCTGAACAACACATTCAACTCGCTGCC
ACTTCCGTCTTCAAGACCGGCAAGTTGGGCAGAACCAAGACCAAGAAGTCCAAGAAGGGA
GGTGCTGCTGCCGACAATGATGACGAATGA


>Contig18343.0.g85(protein)
MPKKYTNYSKTAKSPKRPFEKERLTNELKVIGAYGLKNKREVWRVQFTLAKIRKAARDLL
TLDEKDPRRVFEGDALIRRMVRLGVLKENERKLDYVLGLTLSQIMERRLQTLVAKRKLAN
SVHHARVLIRQRHVAVGKQLVNIPSYLVRVSSEQHIQLAATSVFKTGKLGRTKTKKSKKG
GAAADNDDE