Identifiers and Description

Gene Model Identifier

Contig16691.0.g67

Standard Name

RPS8

Aliases

Contig16691_0_g67

Description

Ribosomal protein S8e

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011516008.999309133990366e-8440S ribosomal protein S8
SGDYER102W6.00073507697681e-75RPS8B SGDID:S000000904, Chr V
from 363100-363702, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16691.0.g67(coding)
ATGGGTATCTCAAGAGACTCTCGCCACAAGAGAAGAGCAACTGGTGGACGTATGCCAGTT
CACTAAAAGAAGAGAAAGTTCGAAATGGGCAGATAAGCAGCCATGACCAAGCTTGGTCCC
AAGGATGTTCGCGCTGTCAGAGGCAGAGGAGGCAACTACAAGTATCGTGCTCTGAGAATC
GATCAAGGTAACTTTGTGTGGCAATCAGAGCAGTTCGCTGGCAAGACCAGAGTTTTGGAC
GTCGTGTACAATGCCACCAACAACGAGCTCGTCAGAACCAAGACCATTGTTAAGAACTCA
ATCGTGCAAGTCGACGCTACTCCCTTCAAGAAGTACTACCTTGAGCACTACGATGTTGAG
CTCGGCAAAAAGAAGGCCGCCGTTGCTGCTCAAGAAGCTGAGAACAAGCCAGAGGAAAAG
AAGAAGAGCAGACACATCCAAGTTGTCCTCAAGAAGAGACAAGCCGGTAGAGTTCTTGAT
ACTCACGTCAGTGAACAATTCAACGCTGGAAGACTCCTCGCCTGCATTGTGTCAAGACCA
GGCCAATCCGGCAGAGCTGATGGTTACATCCTCGAAGGCAAAGAACTCGAGTTCTACATC
AAGAAGATGGAGAAGAAGAAGAAATGA


>Contig16691.0.g67(protein)
MGISRDSRHKRRATGGRMPVHQKKRKFEMGRQAAMTKLGPKDVRAVRGRGGNYKYRALRI
DQGNFVWQSEQFAGKTRVLDVVYNATNNELVRTKTIVKNSIVQVDATPFKKYYLEHYDVE
LGKKKAAVAAQEAENKPEEKKKSRHIQVVLKKRQAGRVLDTHVSEQFNAGRLLACIVSRP
GQSGRADGYILEGKELEFYIKKMEKKKK